Base de dados : LILACS
Pesquisa : B01.050.500.131.617.140 [Categoria DeCS]
Referências encontradas : 72 [refinar]
Mostrando: 1 .. 10   no formato [Detalhado]

página 1 de 8 ir para página                    

  1 / 72 LILACS  
              next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-1089279
Autor: Duarte, J P; Silva, C E; Ribeiro, P B; Cárcamo, M C.
Título: Do dietary stresses affect the immune system of Periplaneta americana (Blattaria: Blattidae)? / Estresses alimentares afetam o sistema immune de Periplaneta americana (Blattaria: Blattidae)?
Fonte: Braz. j. biol;80(1):73-80, Feb. 2020. tab, graf.
Idioma: en.
Projeto: CNPq.
Resumo: Abstract Stresses can be caused by multiple biotic and abiotic factors and their effects can affect both the biology and the immune system of insects. American cockroach - Periplaneta americana (Linnaeus, 1758) (Blattaria: Blattidae) -besides being an excellent model species, has great medical importance because it can act as a mechanical vector of several pathogens. This study aimed to evaluate the influence of starvation, dehydration and both stresses on weight, and total and differential haemocyte count in P. americana adults. Each specimen was isolated in glass flasks containing or not food and/or water. They were weighed periodically. Another group received water for 24 h after the end of stress period. In the immunologic bioassay, we counted their haemocytes after the final weighing. All stresses reduced the insect weight, especially when the stresses were combined. Females of the control group gained weight and males had it unaltered. Different stress conditions and time did not influence on total haemocyte count. Insects without food and water had the proportion of prohaemocytes increased and plasmatocytes decreased. This study can serve as a basis of further studies of bioecology, behaviour and the ability of resisting insecticides, besides serving as a model to studies in other insect species.

Resumo Os estresses podem ser causados por múltiplos fatores bióticos e abióticos e seus efeitos podem afetar tanto a biologia como o sistema imune dos insetos. A barata-americana - Periplaneta americana (Linnaeus, 1758) (Blattaria: Blattidae) - além de ser uma excelente espécie modelo, tem grande importância médica, pois pode atuar como vetor mecânico de diversos patógenos. O objetivo desse estudo foi avaliar a influência da inanição, desidratação e ambos os estresses sobre o peso e o número total e diferencial de hemócitos em adultos de P. americana. Cada espécime foi isolado em frascos de vidro contendo ou não alimento e/ou água. Eles foram pesados periodicamente. Outro grupo recebeu água por 24 h após o término do período de estresse. Nos ensaios imunológicos, foram contados os seus hemócitos após a última pesagem. Todos os estresses reduziram o peso dos insetos, especialmente quando os estresses foram combinados. As fêmeas do grupo controle ganharam peso e os machos tiveram seu peso inalterado. As diferentes condições de estresse e tempo não influenciaram no número total de hemócitos. Os insetos sem alimento e água tiveram a proporção de pró-hemócitos aumentada e a de plasmatócitos reduzida. Esse estudo pode servir como base para estudos posteriores de bioecologia, comportamento e da habilidade de resistir aos inseticidas químicos, além de servir como modelo para estudos em outras espécies de insetos.
Descritores: Periplaneta
Baratas
Inseticidas
-Dieta
Sistema Imunitário
Limites: Animais
Masculino
Feminino
Responsável: BR1.1 - BIREME


  2 / 72 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-773437
Autor: Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang.
Título: Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis
Fonte: J. venom. anim. toxins incl. trop. dis;22:5, 2016. tab, graf, ilus.
Idioma: en.
Projeto: Chinese National Natural Science Foundation; . Research Foundation of Kunming University; . Research Foundation of Kunming University.
Resumo: Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)
Descritores: Peptídeos/isolamento & purificação
Análise de Sequência de DNA/métodos
Baratas/imunologia
Peptídeos Catiônicos Antimicrobianos/química
-Sequência de Aminoácidos
Anti-Infecciosos/análise
Limites: Animais
Responsável: BR1.1 - BIREME


  3 / 72 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
Texto completo
Texto completo
Id: biblio-974009
Autor: Sánchez, Jorge; Sánchez, Andrés; Cardona, Ricardo.
Título: Exposición y sensibilización a insectos en pacientes alérgicos en el trópico / Exposure and sensitization to insects in allergic patients in the tropics
Fonte: Biomédica (Bogotá);38(supl.2):80-86, ago. 2018. tab, graf.
Idioma: es.
Resumo: Introducción. Los ácaros son una importante fuente de alérgenos en el trópico, pero poco se han estudiado otras fuentes potenciales de alérgenos prevalentes en la zona, como los insectos. Objetivo. Determinar la relación entre la exposición y la sensibilización alérgica a cucarachas, mosquitos y hormigas, y su interacción con la sensibilización a los ácaros. Materiales y métodos. Se incluyeron pacientes con pruebas de alergia para Blatella germanica, Aedes aegypti, Solenopsis invicta, Blomia tropicalis, Dermatophagoides farinae y D. pteronyssinus. Se determinó la sensibilización mediada por inmunoglobulina E (IgE) mediante pruebas intraepidérmicas. Para la exposición a los insectos en las casas, se utilizaron trampas para insectos rastreros y voladores. Resultados. Se incluyeron 186 pacientes, de los cuales 73 (39,2 %) presentaron sensibilidad a uno de los insectos (cucarachas: 21 %, mosquitos: 29 %, hormigas: 26,3 %). De estos, 71 (97,2 %) presentaron sensibilización a los ácaros, en tanto que de los 148 pacientes sensibilizados a algún ácaro, solo el 47,9 % lo estaba a algún insecto. Se evaluaron 104 casas: en el 74 %, se encontraron cucarachas, en el 22%, hormigas, y en el 52 %, mosquitos. En los pacientes sensibilizados a los insectos, el número de insectos por casa tuvo una relación directa con el tamaño del habón aparecido durante la prueba cutánea: cucaracha, r=0,781 (p<0,001), mosquito, r=0,811 (p<0,001), hormiga, r=0,840 (p<0,001). Conclusión. La sensibilización a los insectos es frecuente en la población alérgica del trópico y está fuertemente asociada con la sensibilización a los ácaros.

Introduction: Mites are an important source of allergens in the tropics. Other potential sources of allergens prevalent in the region such as insects have been poorly studied. Objective: To determine the relationship between exposure and allergic sensitization to cockroaches, mosquitos, ants and the interaction with mite sensitization. Materials and methods: We included patients with allergy tests for Blatella germanica, Aedes aegypti, Solenopsis invicta, Blomia tropicalis, Dermatophagoides farinae and D. pteronyssinus. IgE sensitization was evaluated by intraepidermal tests. Exposure to insects in houses was evaluated using traps for crawling and flying insects. Results: A total amount of 186 patients were included; 73 (39.2%) of them were sensitized to an insect (cockroaches: 21%, mosquitoes: 29%, ants: 26,3%), 71 (97.2%) also had sensitization to mites. Of the 148 patients sensitized to mites, only 47.9% were sensitized to an insect. In total, 104 houses were evaluated: 74% had cockroaches, 22% ants, and 52% mosquitoes. Among insect-sensitized patients, the number of insects at home was directly related to the size of the weal generated during the skin test: Cockroaches, r=0.781, p<0.001; mosquitoes, r=0.811, p<0.001, and ants, r=0.840, p<0.001. Conclusion: Sensitization to insects is frequent in allergic populations of the tropics and is strongly associated with sensitization to mites.
Descritores: Hipersensibilidade
-Formigas
Baratas
Ácaros
Culicidae
Responsável: CO332 - Facultad de Medicina


  4 / 72 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Id: biblio-942063
Autor: Anônimo.
Título: VISITANTES INDESEJADOS.
Fonte: BRASÍLIA; FUNDAÇÃO HOSPITALAR DO DISTRITO FEDERAL; 1997. 1v p.
Idioma: pt.
Descritores: Baratas/patogenicidade
Culicidae/patogenicidade
Ratos
Limites: Masculino
Feminino
Humanos
Responsável: BR1719.1 - Biblioteca do CPqRR
BR1719.1; Digital 1441, DVD, 1997. 017691


  5 / 72 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
Texto completo
Id: biblio-834070
Autor: Bezerra, Adriana Maia.
Título: Prospecção quantitativa e qualitativa de uma nova fonte renovável de quitosana / Quantitative and qualitative exploration of a new renewable source of chitosan.
Fonte: São Paulo; s.n; dez. 2015. 115 p. tab, graf, ilus.
Idioma: pt.
Tese: Apresentada a Universidade de São Paulo para obtenção do grau de Doutor.
Resumo: A quitosana é um biopolímero funcional com grande potencial de desenvolvimento, podendo gerar diferentes tipos de materiais com variadas funções. Conforme modificações na sua estrutura, a quitosana tem encontrado aplicações nas mais diversas áreas, possuindo um grande leque de aplicações. Apesar do crescente uso da quitosana e do aumento das pesquisas por novas aplicações, a prospecção de outras opções de fontes (que não crustáceos) de quitosana não têm sido consistentemente apresentadas. O objetivo do presente projeto é realizar a prospecção quantitativa e qualitativa de uma nova fonte renovável de quitosana. Temos como uma fonte alternativa para a produção de quitosana, os blatódeos que são comumente conhecidos como baratas. Eles são organismos terrestres que apresentam uma reprodução consideravelmente rápida, se adaptam aos mais variados ambientes e tem o custo de criação baixíssimo devido à sua fácil adaptação ao ambiente e alimentação. Além disso, os blatódeos não possuem sazonalidade, e ainda realizam ecdises, podendo-se utilizar as exúvias para a produção de quitosana. Foram determinados o processo e o rendimento do processo de obtenção de quitosana a partir de blatódeos (Phoetalia pallida). Os blatódeos foram submetidos a tratamento com solução de hidróxido de sódio 50% (p/v) em temperatura de 120 ºC por sete tempos diferentes (1, 2, 3, 6, 10 e 20 horas). As quitosanas obtidas foram caracterizadas mediante técnicas de espectroscopia no Infravermelho (FTIR), comportamento térmico (TG/DTG e DSC), difração de raios-x, viscosimetria e teste de solubilidade. A obtenção de quitosana a partir de blatódeos apresentou vantagens em relação à produção a partir de crustáceos: reduzido número de etapas do processo e dispensa o tratamento com HCl, que é um poluente. O processo de obtenção de quitosana teve rendimento de aproximadamente 15%, variando de acordo com o tempo de reação. De uma maneira geral, as quitosanas de barata apresentaram características semelhantes à quitosana de camarão

Chitosan is a functional biopolymer with great development potential, which can generate different types of materials with several purposes. Depending on changes in its structure, chitosan has found applications in several areas, having a wide range of applications. Despite the increasing use of chitosan and the increase in research for new applications, the exploration of other options as sources of chitosan (other than shellfish) have not been consistently shown. The goal of this project is to conduct a quantitative and qualitative exploration of a new renewable source of chitosan. Blattaria, commonly known as cockroaches, are an alternative source for the production of chitosan. They are terrestrial organisms that present a considerably fast reproduction, adapt to many different environments and have a very low cost of growing, due to its easy adaptation to the environment and food. Moreover, the cockroaches don´t present seasonality and still perform ecdysis, where the exuvia can be used to produce chitosan. The process and the efficiency of the process of obtaining chitosan from the cockroaches, Phoetalia pallida, were determined: they were treated with a solution of sodium hydroxide 50% (w / v) at a temperature of 120 °C for seven different time periods (1, 2, 3, 6, 10 and 20 hours). Chitosans obtained therefrom were characterized by Infrared spectroscopy (FTIR), thermal behavior (TG / DTG and DSC), x-ray diffraction, viscosimetry and solubility test. Obtaining chitosan from cockroaches showed advantages over the production from shellfish: reduced number of process steps and not requiring treatment with HCl, which is a pollutant. The process of obtaining chitosan showed an efficiency of approximately 15%, depending upon the reaction time. In general, the cockroach chitosan showed characteristics similar to shrimp chitosan
Descritores: Quitosana/efeitos adversos
Mineração de Dados/classificação
Tecnologia Farmacêutica/classificação
-Biopolímeros
Baratas/fisiologia
Limites: Animais
Responsável: BR40.1 - DBD - Divisão de Biblioteca e Documentacão do Conjunto das Químicas
BR40.1; T 660, B574p. 30100021990-F


  6 / 72 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-796904
Autor: Durán, Pamela; Siñani, Edda; Depickère, Stéphanie.
Título: On triatomines, cockroaches and haemolymphagy under laboratory conditions: new discoveries
Fonte: Mem. Inst. Oswaldo Cruz;111(10):605-613, Oct. 2016. tab, graf.
Idioma: en.
Resumo: For a long time, haematophagy was considered an obligate condition for triatomines (Hemiptera: Reduviidae) to complete their life cycle. Today, the ability to use haemolymphagy is suggested to represent an important survival strategy for some species, especially those in genus Belminus. As Eratyrus mucronatus and Triatoma boliviana are found with cockroaches in the Blaberinae subfamily in Bolivia, their developmental cycle from egg to adult under a “cockroach diet” was studied. The results suggested that having only cockroach haemolymph as a food source compromised development cycle completion in both species. Compared to a “mouse diet”, the cockroach diet increased: (i) the mortality at each nymphal instar; (ii) the number of feedings needed to molt; (iii) the volume of the maximum food intake; and (iv) the time needed to molt. In conclusion, haemolymph could effectively support survival in the field in both species. Nevertheless, under laboratory conditions, the use of haemolymphagy as a survival strategy in the first developmental stages of these species was not supported, as their mortality was very high. Finally, when Triatoma infestans, Rhodnius stali and Panstrongylus rufotuberculatus species were reared on a cockroach diet under similar conditions, all died rather than feeding on cockroaches. These results are discussed in the context of the ecology of each species.
Descritores: Dieta
Comportamento Alimentar/fisiologia
Hemolinfa
Insetos Vetores/crescimento & desenvolvimento
Triatominae/crescimento & desenvolvimento
-Baratas
Insetos Vetores/fisiologia
Laboratórios
Estágios do Ciclo de Vida/fisiologia
Triatominae/fisiologia
Limites: Animais
Masculino
Feminino
Ratos
Responsável: BR1.1 - BIREME


  7 / 72 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Id: lil-773657
Autor: Anônimo.
Título: VISITANTES INDESEJADOS / UNWANTED VISITOR.
Fonte: BRASÍLIA; FUNDAÇÃO HOSPITALAR DO DISTRITO FEDERAL; 1997. 1v p.
Idioma: pt.
Descritores: Baratas/patogenicidade
Culicidae/patogenicidade
Ratos
Limites: Humanos
Masculino
Feminino
Responsável: BR1719.1 - Biblioteca do CPqRR


  8 / 72 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Id: lil-767309
Autor: Alonso, Angel; Albónico, Julio F; Mouchián, Krikor; Rodríguez, Santiago R; Irañeta, Silvia G; Pionetti, Carlos H.
Título: Cucarachas y vinchucas en patología general y respiratoria / Cockroaches abd vinchucas in general and respiratory pathology
Fonte: Rev. Asoc. Méd. Argent;127(4):22-31, Dic.2014. ilus, graf.
Idioma: es.
Resumo: Se exponen los datos sobre la antigenicidad de las proteasas de la cucaracha Periplaneta americana y de la vinchuca Triatoma infestans en seres humanos residentes en la CABA y Gran Buenos Aires, así como en las provincias del Norte y Noreste del país. La antigenicidad cruzada entre ambas las convierte en 2 insectos de gran importancia en el ecosistema, y sus restos momificados de estadios adultos y ninfales de trascendencia para diversas patologías infecciosas y respiratorias...

Data concerning the cross-reactivity between the serinproteases of the cockroach Periplaneta Americana and the reduviid Triatoma infestans are exposed. Humans living in Buenos Aires as well as those living in the north of the country inhale mummified particles containing the powerful antigens of both insects and develop chronic respiratory illnesses...
Descritores: Baratas/patogenicidade
Doenças Respiratórias/etiologia
Triatominae/patogenicidade
-Argentina
Doenças Transmissíveis/etiologia
Limites: Humanos
Responsável: AR1.1 - Biblioteca Rafael Herrera Vegas


  9 / 72 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-696012
Autor: Sandoval, Claudia Magaly; Medone, Paula; Nieves, Elsa Evelia; Jaimes, Diego Alexander; Ortiz, Nelcy; Rabinovich, Jorge Eduardo.
Título: Demographic fitness of Belminus ferroae (Hemiptera: Triatominae) on three different hosts under laboratory conditions
Fonte: Mem. Inst. Oswaldo Cruz;108(7):854-864, 1jan. 2013. tab, graf.
Idioma: en.
Resumo: Triatominae are widely recognised for their role as vectors of Trypanosoma cruzi. One of the main biological characteristics of this subfamily is their obligate haematophagous condition. However, previous studies on Belminus herreri and Belminus ferroae suggested that cockroaches are their principal hosts in domiciles. Due to this peculiar behaviour, the aim of this study was to analyse several demographic and reproductive parameters of B. ferroae fed on three different hosts (mice, cockroaches and Rhodnius prolixus) and relate B. ferroae fitness to these alternative hosts. The cohorts were reared under constant conditions. The egg hatching rate was similar for cohorts fed on cockroaches (69.4%) and R. prolixus (63.8%), but was much lower for the cohort fed on mice (16%). The development time from the nymph to adult stage and the average age of first reproduction (α) presented lower values in the cohort fed on cockroaches, which is consistent with the higher population growth rate associated with this host. Demographic parameters [intrinsic rate of natural increase, finite rate of population growth, net reproductive rate and damping ratio] showed statistically significant differences between the cohorts. Analysis of the life history of B. ferroae revealed a higher fitness related to the cockroach. The implications of these results for the origin of the subfamily are discussed.
Descritores: Comportamento Alimentar/fisiologia
Interações Hospedeiro-Parasita/fisiologia
Insetos Vetores/fisiologia
Triatominae/fisiologia
-Baratas
Insetos Vetores/crescimento & desenvolvimento
Estágios do Ciclo de Vida
Reprodução
Razão de Masculinidade
Triatominae/crescimento & desenvolvimento
Limites: Animais
Feminino
Masculino
Camundongos
Tipo de Publ: Research Support, Non-U.S. Gov't
Responsável: BR1.1 - BIREME


  10 / 72 LILACS  
              first record previous record
seleciona
para imprimir
Id: lil-641066
Autor: Messias, Maria Conceição.
Título: Vivendo com os insetos / Living with insects.
Fonte: Rio de Janeiro; Biomanguinhos. FIOCRUZ; 2011. 120 p. ilus.
Idioma: pt.
Descritores: Entomologia
Insetos
-Formigas
Percevejos-de-Cama
Baratas
Culicidae
Dípteros
Isópteros
Ftirápteros
Triatominae
Limites: Humanos
Animais
Criança
Adolescente
Responsável: BR58.1 - Biblioteca
BR58.1; 595.7, M585v. 1116



página 1 de 8 ir para página                    
   


Refinar a pesquisa
  Base de dados : Formulário avançado   

    Pesquisar no campo  
1  
2
3
 
           



Search engine: iAH v2.6 powered by WWWISIS

BIREME/OPAS/OMS - Centro Latino-Americano e do Caribe de Informação em Ciências da Saúde