Base de dados : LILACS
Pesquisa : B01.050.500.131.617.140 [Categoria DeCS]
Referências encontradas : 80 [refinar]
Mostrando: 1 .. 10   no formato [Detalhado]

página 1 de 8 ir para página                    

  1 / 80 LILACS  
              next record last record
seleciona
para imprimir
Fotocópia
Texto completo
Texto completo
Texto completo
Id: biblio-1279647
Autor: Camargo-Assis, Francisco; Máttar, Salim; González T, Marco.
Título: Lophomonas blattarum parásito de cucarachas que causa neumonías infrecuentes en humanos / Lophomonas blattarum cockroach parasite that causes uncommon pneumonia in humans
Fonte: Rev. MVZ Córdoba;25(1):1-3, ene.-abr. 2020.
Idioma: es.
Descritores: Baratas
-Parasitos
Pneumonia
Limites: Humanos
Animais
Tipo de Publ: Editorial
Responsável: CO140 - Facultad de Medicina Veterinária y Zootecnia


  2 / 80 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Chile
Texto completo
Id: biblio-950713
Autor: Yan, Yizhong; Li, Jianjun; Zhang, Yiya; Peng, Xiaozhen; Guo, Tianyao; Wang, Jirong; Hu, Weijun; Duan, Zhigui; Wang, Xianchun.
Título: Physiological and biochemical characterization of egg extract of black widow spiders to uncover molecular basis of egg toxicity
Fonte: Biol. Res;47:1-11, 2014. ilus, graf, tab.
Idioma: en.
Projeto: National Natural Science Foundation of China; . Hunan Provincial Natural Science Foundation of China; . Innovation Center of Engineering and New Products for Developmental Biology of Hunan Province. National Basic Research Program or \"973 Program.
Resumo: BACKGROUND: Black widow spider (L. tredecimguttatus) has toxic components not only in the venomous glands, but also in other parts of the body and its eggs. It is biologically important to investigate the molecular basis of the egg toxicity. RESULTS: In the present work, an aqueous extract was prepared from the eggs of the spider and characterized using multiple physiological and biochemical strategies. Gel electrophoresis and mass spectrometry demonstrated that the eggs are rich in high-molecular-mass proteins and the peptides below 5 kDa. The lyophilized extract of the eggs had a protein content of 34.22% and was shown to have a strong toxicity towards mammals and insects. When applied at a concentration of 0.25 mg/mL, the extract could completely block the neuromuscular transmission in mouse isolated phrenic nerve-hemidiaphragm preparations within 12.0 ± 1.5 min. Using whole-cell patch-clamp technique, the egg extract was demonstrated to be able to inhibit the voltage-activated Na+, K+and Ca2+ currents in rat DRG neurons. In addition, the extract displayed activities of multiple hydrolases. Finally, the molecular basis of the egg toxicity was discussed. CONCLUSIONS: The eggs of black widow spiders are rich in proteinous compounds particularly the high-molecular-mass proteins with different types of biological activity The neurotoxic and other active compounds in the eggs are believed to play important roles in the eggs' toxic actions.
Descritores: Óvulo/química
Extratos de Tecidos/química
Viúva Negra/química
Proteínas de Artrópodes/toxicidade
-Óvulo/fisiologia
Nervo Frênico/efeitos dos fármacos
Extratos de Tecidos/toxicidade
Canais de Cálcio/efeitos dos fármacos
Baratas/efeitos dos fármacos
Canais de Potássio de Abertura Dependente da Tensão da Membrana/efeitos dos fármacos
Exoesqueleto/fisiologia
Exoesqueleto/química
Proteínas de Artrópodes/isolamento & purificação
Canais de Sódio Disparados por Voltagem/efeitos dos fármacos
Gânglios Espinais/efeitos dos fármacos
Limites: Animais
Camundongos
Ratos
Tipo de Publ: Research Support, Non-U.S. Gov't
Responsável: CL1.1 - Biblioteca Central


  3 / 80 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-393994
Autor: Lopes, Sonia Maria; Oliveira, Edivar Heeren de; Araújo, Maria Carmosina de.
Título: Novo registro de Doradoblatta coppenamensis Bruijning, 1959 no Brasil (Blattaria, Blattellidae) e descrição da genitália masculina / New Records of Doradoblatta coppenamensis Bruijning, 1959 from Brazil (Blattaria, Blattellidae) with Description of the male genitalia
Fonte: Acta amaz;34(3):503-504, jul.-set. 2004. ilus.
Idioma: pt.
Resumo: É registrada pela primeira vez a presença de Doradoblatta coppenamensis Bruijning, 1959 nos Estados do Amazonas e Mato Grosso (Brasil); são complementados os dados originais com a descrição e ilustração da genitália masculina da espécie, e são apresentadas considerações sobre o gênero.
Descritores: Registros
Classificação
Baratas
Responsável: BR6.1 - BCS - Biblioteca de Ciências da Saúde


  4 / 80 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-512636
Autor: Lopes, Sonia Maria; Oliveira, Edivar Heeren de; Araújo, Maria Carmosina de.
Título: Novos registros de Phoetalia pallida (Brunner, 1865) para o Brasil e considerações sobre a variação cromática da espécie (Blattaria, Blaberidae, Blaberinae) / New records of Phoetalia pallida (Brunner, 1865) from Brazil and considerations about the chromatic variation of the species (Blattaria, Blaberidae, Blaberinae)
Fonte: Acta amaz;34(4):665-667, out.-dez. 2004. ilus.
Idioma: pt.
Resumo: Apresenta-se um novo registro de Phoetalia pallida (Brunner, 1865) para o Brasil, nas regiões norte, nordeste e centro-oeste, é descrita, pela primeira vez, a genitália da espécie e é analisada a variação cromática de pronoto e cabeça, entre as localidades assinaladas.

A new record of Phoetalia pallida (Brunner, 1865) from Brazil is presented, in the north, northeast and central-west areas, the genitalia of the species is described for the first time, and the chromatic variation of pronotum and head, is analysed among specimens of the marked locations.
Descritores: Classificação
Baratas
Responsável: BR6.1 - BCS - Biblioteca de Ciências da Saúde


  5 / 80 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-429322
Autor: Lopes, Sonia Maria; Oliveira, Edivar Heeren de.
Título: Descrição de Xestoblatta mamorensis sp. nov. (Blattellidae: Blattaria), do estado de Rondônia, Brasil / Description of Xestoblatta mamorensis sp. nov. (Blattellidae: Blattaria), from Rondônia State, Brazil
Fonte: Acta amaz;36(1):129-131, jan.-mar. 2006. ilus.
Idioma: pt.
Resumo: Xestoblatta mamorensis sp. nov. é descrita do Estado de Rondônia (Brasil). Foram utilizadas para sua determinação a morfologia das placas genitais e genitália do macho e presença de especialização abdominal em mais de um segmento.
Descritores: Classificação
Baratas
Responsável: BR6.1 - BCS - Biblioteca de Ciências da Saúde


  6 / 80 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-474449
Autor: Lopes, Sonia Maria; Oliveira, Edivar Heeren de; Araújo, Maria Carmosina de.
Título: Espécie nova de Euphyllodromia Shelford, 1908 do estado de Rondônia, Brasil e nova ocorrência de E. jugata Rehn, 1928 (Blattaria, Blattellidae) / New species of Euphyllodromia Shelford, 1908 from Rondônia State, Brazil and new occurrence for E. jugata Rehn, 1928 (Blattaria, Blattellidae)
Fonte: Acta amaz;37(3):479-482, 2007. ilus.
Idioma: pt.
Resumo: Euphyllodromiarondonensis sp. nov. é descrita do Estado de Rondônia, Brasil, com base na genitália do macho. É assinalada uma nova ocorrência para E. jugata Rehn, 1928, coletada em ninho de vespas no estado do Acre.

Euphyllodromiarondonensis, sp. nov. is described from the Rondônia State, Brazil, based on the male genitalia. It's assinalated the new occurrence for E. jugata Rehn, 1928 from Acre State collected in wasps nest.
Descritores: Classificação
Baratas
Responsável: BR6.1 - BCS - Biblioteca de Ciências da Saúde


  7 / 80 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-482520
Autor: Rafael, José Albertino; Silva, Neliton Marques da; Dias, Racy Manuel Najar Sarmento.
Título: Baratas (Insecta, Blattaria) sinantrópicas na cidade de Manaus, Amazonas, Brasil / Synantropic cockroaches (Insecta, Blattaria) from Manaus, Amazonas, Brazil
Fonte: Acta amaz;38(1):173-178, 2008. ilus.
Idioma: pt.
Resumo: A coleta de baratas na cidade de Manaus resultou em seis espécies associadas às habitações, estabelecimentos comerciais e educacionais, sendo quatro predominantemente dentro das habitações, Blatella germanica (Linnaeus, 1758), Supella longipalpa (Fabricius, 1798), Periplaneta americana (Linnaeus, 1758), P. australasiae (Fabricius, 1775) e duas fora das habitações, Pycnoscelus surinamensis (Linnaeus, 1758) e Blaberus parabolicus Walker, 1868. P. americana foi comum tanto interna como externamente às instalações urbanas; P. australasiae foi predominante em barcos; P. surinamensis e B. parabolicus foram invasoras ocasionais de residências na estação chuvosa. São apresentadas fotos coloridas, em tamanho natural, para reconhecimento das espécies.

Collection of cockroaches from Manaus resulted in six species associated to human house, commercial buildings and educational buildings, being four species found predominantly indoor, Blatella germanica (Linnaeus, 1758), Supella longipalpa (Fabricius, 1798), Periplaneta americana (Linnaeus, 1758) and P. australasiae (Fabricius, 1775) and two species found predominantly outdoor, Pycnoscelus surinamensis (Linnaeus, 1758) and Blaberus parabolicus Walker, 1868 the latter two occasionally house-infesting species in the rainy season. P. americana was common either indoor and outdoor and P. australasiae infesting mainly boats. Color figures in natural size are presented for all species in order to help their identification.
Descritores: Baratas
Insetos
-Entomologia
Responsável: BR6.1 - BCS - Biblioteca de Ciências da Saúde


  8 / 80 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-482521
Autor: Ribeiro, José Ricardo Inacio; Alecrim, Viviani Pereira.
Título: Duas novas espécies de Belostoma Latreille, 1807 (Hemiptera: Heteroptera: Belostomatidae) do grupo plebejum sensu Nieser, 1975 / Two new species of Belostoma Latreille, 1807 (Hemiptera: Heteroptera: Belostomatidae) of plebejum group sensu Nieser, 1975
Fonte: Acta amaz;38(1):179-188, 2008. ilus.
Idioma: pt.
Resumo: Representantes do grupo plebejum são encontrados de Honduras até o sul da América do Sul e compreendem sete espécies de pequeno porte. Como resultado de um estudo de revisão do grupo, são descritas duas espécies novas: Belostoma estevezae Ribeiro & Alecrim, sp. nov., do Estado do Mato Grosso, Brasil, similar a B. nicaeum Estévez & Polhemus, 2007, em termos de carena prosternal, e B. nessimiani Ribeiro & Alecrim, sp. nov., do Estado do Amazonas, Brasil, sendo bastante similar a B. parvum Estévez & Polhemus, 2007, em termos de genitália masculina. Uma chave de identificação para as espécies do grupo plebejum com as espécies novas incluídas é fornecida.

Species of plebejum group comprises seven extant small species of giant water bugs. This group is currently reported from Honduras to southern South America. Two new species are described as a result from a revisional study of this group: Belostoma estevezae Ribeiro & Alecrim, sp. nov., from Mato Grosso State, Brazil, and B. nessimiani Ribeiro & Alecrim, sp. nov., from Amazonas State, Brazil. The prosternal keel of B. estevezae, sp. nov., is similar to that of B. nicaeum Estévez & Polhemus, 2007, while the male genitalia structures of B. nessimiani, sp. nov., is similar to those of B. parvum Estévez & Polhemus, 2007. A key to the species of plebejum group with new species included is also provided.
Descritores: Classificação
Baratas
Ecossistema Tropical
Responsável: BR6.1 - BCS - Biblioteca de Ciências da Saúde


  9 / 80 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-1089279
Autor: Duarte, J P; Silva, C E; Ribeiro, P B; Cárcamo, M C.
Título: Do dietary stresses affect the immune system of Periplaneta americana (Blattaria: Blattidae)? / Estresses alimentares afetam o sistema immune de Periplaneta americana (Blattaria: Blattidae)?
Fonte: Braz. j. biol;80(1):73-80, Feb. 2020. tab, graf.
Idioma: en.
Projeto: CNPq.
Resumo: Abstract Stresses can be caused by multiple biotic and abiotic factors and their effects can affect both the biology and the immune system of insects. American cockroach - Periplaneta americana (Linnaeus, 1758) (Blattaria: Blattidae) -besides being an excellent model species, has great medical importance because it can act as a mechanical vector of several pathogens. This study aimed to evaluate the influence of starvation, dehydration and both stresses on weight, and total and differential haemocyte count in P. americana adults. Each specimen was isolated in glass flasks containing or not food and/or water. They were weighed periodically. Another group received water for 24 h after the end of stress period. In the immunologic bioassay, we counted their haemocytes after the final weighing. All stresses reduced the insect weight, especially when the stresses were combined. Females of the control group gained weight and males had it unaltered. Different stress conditions and time did not influence on total haemocyte count. Insects without food and water had the proportion of prohaemocytes increased and plasmatocytes decreased. This study can serve as a basis of further studies of bioecology, behaviour and the ability of resisting insecticides, besides serving as a model to studies in other insect species.

Resumo Os estresses podem ser causados por múltiplos fatores bióticos e abióticos e seus efeitos podem afetar tanto a biologia como o sistema imune dos insetos. A barata-americana - Periplaneta americana (Linnaeus, 1758) (Blattaria: Blattidae) - além de ser uma excelente espécie modelo, tem grande importância médica, pois pode atuar como vetor mecânico de diversos patógenos. O objetivo desse estudo foi avaliar a influência da inanição, desidratação e ambos os estresses sobre o peso e o número total e diferencial de hemócitos em adultos de P. americana. Cada espécime foi isolado em frascos de vidro contendo ou não alimento e/ou água. Eles foram pesados periodicamente. Outro grupo recebeu água por 24 h após o término do período de estresse. Nos ensaios imunológicos, foram contados os seus hemócitos após a última pesagem. Todos os estresses reduziram o peso dos insetos, especialmente quando os estresses foram combinados. As fêmeas do grupo controle ganharam peso e os machos tiveram seu peso inalterado. As diferentes condições de estresse e tempo não influenciaram no número total de hemócitos. Os insetos sem alimento e água tiveram a proporção de pró-hemócitos aumentada e a de plasmatócitos reduzida. Esse estudo pode servir como base para estudos posteriores de bioecologia, comportamento e da habilidade de resistir aos inseticidas químicos, além de servir como modelo para estudos em outras espécies de insetos.
Descritores: Periplaneta
Baratas
Inseticidas
-Dieta
Sistema Imunitário
Limites: Animais
Masculino
Feminino
Responsável: BR1.1 - BIREME


  10 / 80 LILACS  
              first record previous record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-773437
Autor: Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang.
Título: Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis
Fonte: J. venom. anim. toxins incl. trop. dis;22:5, 2016. tab, graf, ilus.
Idioma: en.
Projeto: Chinese National Natural Science Foundation; . Research Foundation of Kunming University; . Research Foundation of Kunming University.
Resumo: Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)
Descritores: Peptídeos/isolamento & purificação
Análise de Sequência de DNA/métodos
Baratas/imunologia
Peptídeos Catiônicos Antimicrobianos/química
-Sequência de Aminoácidos
Anti-Infecciosos/análise
Limites: Animais
Responsável: BR1.1 - BIREME



página 1 de 8 ir para página                    
   


Refinar a pesquisa
  Base de dados : Formulário avançado   

    Pesquisar no campo  
1  
2
3
 
           



Search engine: iAH v2.6 powered by WWWISIS

BIREME/OPAS/OMS - Centro Latino-Americano e do Caribe de Informação em Ciências da Saúde