Base de dados : LILACS
Pesquisa : D12.644 [Categoria DeCS]
Referências encontradas : 359 [refinar]
Mostrando: 1 .. 10   no formato [Detalhado]

página 1 de 36 ir para página                         

  1 / 359 LILACS  
              next record last record
seleciona
para imprimir
Alves, Silvana Gomes
Id: biblio-1077927
Autor: Sette, Jorge Bezerra Cavalcante; Keiralla, Luísa Carolina Borges; Santana, Marcus R de Oliveira; Alves, Silvana Gomes; Martins, Tiago Prado.
Título: Peptídeos natriuréticos na prática cardilógica / Natriuretic peptides in cardilógica practice.
Fonte: São Paulo; IDPC; 2008. 71 p.
Idioma: pt.
Resumo: A partir de 1950 foi observada a relação entre o coração e o controle da excreção renal de sal e água que, posteriormente, foi atribuída à substâncias do sistema hormonal cardíaco natriurético...
Descritores: Cardiologia
Peptídeos
Peptídeos Natriuréticos
Responsável: BR79.1 - CIC - Centro de Informação Cardiovascular Mendonça de Barros
BR79.1


  2 / 359 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Id: biblio-1073747
Autor: Lin-Wang, Hui Tzu.
Título: Autorreatividade humoral a peptídeos da miosina cardíaca e proteína de choque térmico 60: estudo sequencial em pacientes transplantados cardíacos e indivíduos sadios / HUMORAL AUTOREACTIVITY TO PEPTIDES FROM CARDIAC MYOSIN AND HEAT SHOCK PROTEIN 60: SEQUENTIAL STUDY IN HEART TRANSPLANTED PATIENTS AND HEALTHY SUBJECTS.
Fonte: São Paulo; FMUSP; 2009. 167 p.
Idioma: pt.
Resumo: A resposta imune dirigida a autoantígenos pode contribuir para a patogênese das doenças autoimunes. Porém, também é discutido o papel imunorregulador da autoimunidade em processos inflamatórios e na rejeição do aloenxerto. Nós pesquisamos os autoanticorpos IgG e IgM reativos a peptídeos da miosina cardíaca (MC) e da proteína de choque térmico 60 (Hsp60) no soro de indivíduos sadios (IS, n=30; 3 momentos com intervalos de 6 meses) e indivíduos transplantados cardíacos (Tx, n=65, > 2 amostras/indivíduo, de diferentes períodos Tx: pré-Tx, T1: 5 anos), por ensaio imunoenzimático (ELISA). Todos os sujeitos do estudo tiveram anticorpos IgG ou IgM que reconheceram pelo menos um dos peptídeos avaliados. Os anticorpos IgG de indivíduos Tx reconheceram mais peptídeos do que dos IS, para a MC (12,2 ± 8,5, intervalo: 1–32 peptídeos versus 5,2 ± 3,0, intervalo: 0-14; p<0,0001), e para a Hsp60 (6,0 ± 4,4, intervalo: 0-18 versus 3,9 ± 3,0, intervalo: 0-12; p=0,0208). A frequência de indivíduos positivos para os anticorpos IgG foi maior no grupo Tx do que nos sadio (p<0,05), com reatividade para a maioria dos peptídeos da MC e da Hsp60. Em contraste, a frequência de indivíduos positivos para os anticorpos IgM foi maior no grupo de IS do que no Tx (p<0,05), principalmente para a reatividade dirigida aos peptídeos da MC...
Descritores: Autoanticorpos
CHAPERONINA ACCESSORY NERVE
Chaperoninas
Miosinas Cardíacas
Peptídeos
Transplante de Coração
Responsável: BR79.1 - CIC - Centro de Informação Cardiovascular Mendonça de Barros
BR79.1


  3 / 359 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-886225
Autor: Costa, Beatriz Pinto da; Gonçalves, Ana Cristina; Abrantes, Ana Margarida; Matafome, Paulo; Seiça, Raquel; Sarmento-Ribeiro, Ana Bela; Botelho, Maria Filomena; Castro-Sousa, Francisco.
Título: Intestinal inflammatory and redox responses to the perioperative administration of teduglutide in rats
Fonte: Acta cir. bras;32(8):648-661, Aug. 2017. tab, graf.
Idioma: en.
Resumo: Abstract Purpose: To investigate the inflammatory and redox responses to teduglutide on an animal model of laparotomy and intestinal anastomosis. Methods: Wistar rats (n=62) were allocated into four groups: "Ileal Resection and Anastomosis" vs. "Laparotomy", each one split into "Postoperative Teduglutide Administration" vs. "No Treatment"; and euthanized at the third or the seventh day. Ileal and blood samples were recovered at the baseline and at the euthanasia. Flow cytometry was used to study the inflammatory response (IL-1α, MCP-1, TNF-α, IFN-γ and IL-4 levels), oxidative stress (cytosolic peroxides, mitochondrial reactive species, intracellular glutathione and mitochondrial membrane potential) and cellular viability and death (annexin V/propidium iodide double staining). Results: Postoperative teduglutide treatment was associated with higher cellular viability index and lower early apoptosis ratio at the seventh day; higher cytosolic peroxides level at the third day and mitochondrial overgeneration of reactive species at the seventh day; higher tissue concentration of IL-4 and lower local pro-to-anti-inflammatory cytokines ratio at the seventh day. Conclusion: Those findings suggest an intestinal pro-oxidative and anti-inflammatory influence of teduglutide on the peri-operative context with a potential interference in the intestinal anastomotic healing.
Descritores: Oxirredução/efeitos dos fármacos
Peptídeos/farmacologia
Íleo/cirurgia
Íleo/efeitos dos fármacos
Íleo/patologia
Anti-Inflamatórios/farmacologia
-Fatores de Tempo
Cicatrização/efeitos dos fármacos
Anastomose Cirúrgica
Distribuição Aleatória
Sobrevivência Celular/efeitos dos fármacos
Reprodutibilidade dos Testes
Citocinas/sangue
Resultado do Tratamento
Ratos Wistar
Apoptose
Estresse Oxidativo/efeitos dos fármacos
Modelos Animais de Doenças
Citometria de Fluxo
Íleo/metabolismo
Laparotomia
Limites: Animais
Masculino
Tipo de Publ: Estudo de Avaliação
Responsável: BR1.1 - BIREME


  4 / 359 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-623616
Autor: Ramos, R; Juri, M. A; Ramos, A; Hoecker, G; Ferreira, A.
Título: An immunodominant and immunogenetically defined polipeptide present in T. cruzi
Fonte: Mem. Inst. Oswaldo Cruz;83(supl.1):418-418, Nov. 1988.
Idioma: en.
Conferência: Apresentado em: Annual Meeting on Basic Research in Chagas's disease, 15, Apresentado em: Meeting of the Brazilian Society of Protozoology4, Caxambu, 7-10 Nov. 1988.
Projeto: FONDECYT; . UNDP; . World Bank; . WHO; . TDR.
Descritores: Trypanosoma cruzi/genética
Doença de Chagas/imunologia
-Peptídeos/análise
Peptídeos/genética
Western Blotting
Responsável: BR1.1 - BIREME


  5 / 359 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-773437
Autor: Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang.
Título: Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis
Fonte: J. venom. anim. toxins incl. trop. dis;22:5, 2016. tab, graf, ilus.
Idioma: en.
Projeto: Chinese National Natural Science Foundation; . Research Foundation of Kunming University; . Research Foundation of Kunming University.
Resumo: Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)
Descritores: Peptídeos/isolamento & purificação
Análise de Sequência de DNA/métodos
Baratas/imunologia
Peptídeos Catiônicos Antimicrobianos/química
-Sequência de Aminoácidos
Anti-Infecciosos/análise
Limites: Animais
Responsável: BR1.1 - BIREME


  6 / 359 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
Id: biblio-1015831
Autor: Zhang, Xichun; Du, Junmin; Wang, Yu; Chen, Shuming; Wang, Yingli.
Título: Escherichia coli GutM4 produces 2, 5-diketopiperazines and inhibits human pathogens in vitro
Fonte: Electron. j. biotechnol;28:35-40, July. 2017. ilus, tab.
Idioma: en.
Projeto: Shanxi Scholarship Council of China.
Resumo: Background: It has been a very common practice to use probiotics or their metabolites as alternative antimicrobial strategies for the treatment and prevention of infections as rampant and indiscriminate use of antibiotics causes the development of antibiotic-resistant pathogens. The objective of this study was to select a potential antimicrobial probiotic strain of Escherichia coli from the human gastrointestinal tract and investigate the production of diketopiperazines that contribute to the antimicrobial activity. Results: E. coli GutM4 was isolated from the feces of a healthy adult. E. coli GutM4 showed significant antagonistic activity against 10 indicator pathogens, and this activity was no less than that of the reference strain E. coli Nissle 1917 against eight of the indicator pathogens. Moreover, E. coli GutM4 produced antagonistic substances containing trypsin-targeted peptide bonds because the inhibitory effects of E. coli GutM4 supernatant significantly decreased upon treatment with trypsin. Consistent with the antagonistic activity and peptide compounds of E. coli GutM4, 14 2,5-diketopiperazines were isolated from the fermented broth of E. coli GutM4, including 12 cyclo(Pro-Phe), 3 cyclo(Pro-Tyr), and 5 cyclo(4-hydroxyl-Pro-Leu), which are reported to have antipathogenic activity. Conclusion: E. coli GutM4 produces 2,5-diketopiperazines that are partly involved in antagonistic action against human pathogens in vitro.
Descritores: Probióticos/farmacologia
Escherichia coli/metabolismo
Dicetopiperazinas/farmacologia
-Peptídeos
Bactérias/efeitos dos fármacos
Técnicas In Vitro
Candida albicans/efeitos dos fármacos
Probióticos/metabolismo
Escherichia coli/isolamento & purificação
Dicetopiperazinas/metabolismo
Fezes/microbiologia
Microbioma Gastrointestinal
Limites: Humanos
Responsável: CL1.1 - Biblioteca Central


  7 / 359 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Chile
Texto completo
Id: biblio-1003695
Autor: Herrera-Ponce, Ana Luisa; Alarcón-Rojo, Alma Delia; Salmeron, Iván; Rodríguez-Figueroa, José Carlos.
Título: Efectos fisiológicos de los péptidos bioactivos derivados de las proteínas del lactosuero en la salud: Una revisión / Physiological health effects of whey protein-derived bioactive peptides: A review
Fonte: Rev. chil. nutr;46(2):205-214, abr. 2019. tab.
Idioma: es.
Projeto: CONACYT.
Resumo: RESUMEN El lactosuero es un subproducto derivado de la elaboración de queso. La calidad de la composición química de las proteínas del lactosuero las convierte en un sustrato ideal para la generación de péptidos con actividad biológica. La presente revisión tiene por objetivo analizar y discutir los efectos fisiológicos de los péptidos bioactivos derivados de las proteínas del lactosuero (PBDL) en la salud. Asimismo, este trabajo muestra detalladamente las estructuras químicas de las secuencias de los PBDL capaces de ejercer efectos favorables in vitro e in vivo e influir positivamente en los sistemas cardiovascular, endócrino e inmunológico. Sin embargo, las metodologías para generar PBDL de manera controlada, la dosificación y las concentraciones óptimas han sido poco exploradas. Por lo que es importante llevar a cabo investigación de frontera que permita avanzar el umbral del conocimiento vislumbrando la posibilidad de utilizar los PBDL como coadyuvantes en la prevención y tratamiento de enfermedades.

ABSTRACT Whey is a by-product of cheese production. The relevant chemical composition of whey proteins makes them an ideal substrate to release peptides with biological activity. The objective of this manuscript was to analyze and discuss the effects of whey-derived proteins bioactive peptides in health. Moreover, this review shows in detail sequences able to benefit human systems. Several in vitro and in vivo studies showed the capacity of these bioactive peptides to positively influence cardiovascular, endocrine and immune systems. However, the methodologies to obtain them in a controlled way, as well as dose and optimum concentrations have been scarcely explored. Therefore, it is necessary to conduct new research to improve knowledge that focuses on the possibility of using whey-derived bioactive peptides in the prevention and treatment of diseases.
Descritores: Peptídeos
Sistema Cardiovascular
Proteínas
Impactos na Saúde
Sistema Endócrino
Soro do Leite
Sistema Imunitário
Limites: Humanos
Tipo de Publ: Revisão
Responsável: CL334.1 - Biblioteca UBO


  8 / 359 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-954851
Autor: Costa, Fábio L. S; Lima, Maria Elena De; Figueiredo, Suely G; Ferreira, Rafaela S; Prates, Núbia S; Sakamoto, Tetsu; Salas, Carlos E.
Título: Sequence analysis of the cDNA encoding for SpCTx: a lethal factor from scorpionfish venom ( Scorpaena plumieri )
Fonte: J. venom. anim. toxins incl. trop. dis;24:24, 2018. tab, ilus.
Idioma: en.
Projeto: CAPES; . CNPq/CAPES.
Resumo: Lethal factors are multifunctional oligomeric proteins found in the venomous apparatus of Scorpaeniformes fish. These toxins elicit not only an array of biological responses in vitro but also cardiovascular disorders and strong hemolytic, nociceptive and edematogenic activities in vivo. This work describes the cloning and molecular identification of two toxin subunits, denominated Sp-CTx-α and Sp-CTx-ß, from scorpionfish venom ( Scorpaena plumieri ). Methods: The primary structures were deduced after cDNA amplification by PCR with primers from conserved sequences described in Scorpaeniformes toxins. Following DNA sequencing and bioinformatic analysis, the tridimensional structures of both subunits were modeled. Results: The translated sequences (702 amino acids, each subunit) show homology with other lethal factors, while alignment between Sp-CTx-α and Sp-CTx-ß shows 54% identity. The subunits lack N-terminal signal sequences and display masses of approximately 80 kDa each. Both Sp-CTx subunits display a B30.2/SPRY domain at the C-terminal region with typically conserved motifs as described in these toxins. Secondary structure prediction identified six α-helices 18 residues long in both α and ß subunits, some of them amphiphilic with their N-terminal flanked by many basic residues, creating a cationic site associated with the cytolytic activity of these toxins. Antimicrobial potential sites were identified in Sp-CTx and share some features with other peptides presenting variable and broad-spectrum activity. A phylogenetic tree built to represent these toxins supports the proximity between scorpionfish, lionfish and stonefish. Conclusion: The study identified a putative toxin protein whose primary structure is similar to other fish toxins and with potential for production of antivenom against scorpionfish envenomation in Brazil. As a prelude to structure-function studies, we propose that the toxin is structurally related to pore-forming marine toxins.(AU)
Descritores: DNA Complementar/análise
Venenos de Peixe/toxicidade
-Peptídeos/análise
Antivenenos/classificação
Reação em Cadeia da Polimerase/métodos
Sequência de Aminoácidos
Limites: Animais
Responsável: BR33.1 - Divisão Técnica de Biblioteca e Documentação


  9 / 359 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-894167
Autor: Cologna, Camila Takeno; Rodrigues, Renata Santos; Santos, Jean; Pauw, Edwin de; Arantes, Eliane Candiani; Quinton, Loïc.
Título: Peptidomic investigation of Neoponera villosa venom by high-resolution mass spectrometry: seasonal and nesting habitat variations
Fonte: J. venom. anim. toxins incl. trop. dis;24:6, 2018. tab, graf, ilus.
Idioma: en.
Projeto: São Paulo Research Foundation (FAPESP); . National Council for Scientific and Technological Development (CNPq).
Resumo: Advancements in proteomics, including the technological improvement in instrumentation, have turned mass spectrometry into an indispensable tool in the study of venoms and toxins. In addition, the advance of nanoscale liquid chromatography coupled to nanoelectrospray mass spectrometry allows, due to its high sensitivity, the study of venoms from species previously left aside, such as ants. Ant venoms are a complex mixture of compounds used for defense, predation or communication purposes. The venom from Neoponera ants, a genus restricted to Neotropical regions, is known to have cytolytic, hemolytic, antimicrobial and insecticidal activities. Moreover, venoms from several Neoponera species have been compared and differences in their toxicity related to nesting habitat variation were reported. Therefore, the present study aimed to perform a deep peptidomic analysis of Neoponera villosa venom and a comparison of seasonal and nesting habitat variations using high-resolution mass spectrometry. Methods: Specimens of N. villosa ants were captured in Panga Natural Reserve (Uberlândia, MG, Brazil) from arboreal and ground-dwelling nests during summer and winter time. The venom glands were dissected, pooled and disrupted by ultra-sonic waves. The venom collected from different habitats (arboreal and ground-dwelling) and different seasons (summer and winter) was injected into a nanoACQUITY ULPC hyphened to a Q-Exactive Orbitrap mass spectrometer. The raw data were analyzed using PEAKS 7. Results: The results showed a molecular diversity of more than 500 peptides among these venoms, mostly in the mass range of 800-4000 Da. Mutations and post-translational modifications were described and differences among the venoms were observed. Part of the peptides matched with ponericins, a well-known antimicrobial peptide family. In addition, smaller fragments related to ponericins were also identified, suggesting that this class of antimicrobial peptide might undergo enzymatic cleavages. Conclusion: There are substantial differences among the venom of N. villosa ants collected in different seasons and from different nest habitats. The venom composition is affected by climate changes that influence prey availability and predator presence. Clearly, nano-LC-MS boosted the knowledge about ant venom, a rich source of unexplored and promising bioactive compounds.(AU)
Descritores: Peptídeos/análise
Estações do Ano
Espectrometria de Massas/métodos
Venenos de Formiga/análise
Comportamento de Nidação
Limites: Animais
Responsável: BR33.1 - Divisão Técnica de Biblioteca e Documentação


  10 / 359 LILACS  
              first record previous record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-984626
Autor: Gee, Tikfu; Lee, Limi; Liew, Ngoh Chin; Lim, Shu Yu; Ghani, Nur Suriyana Abd; Martindale, Robert G.
Título: Efficacy of low residue enteral formula versus clear liquid diet during bowel preparation for colonoscopy: a randomised controlled pilot trial / Eficácia da fórmula enteral pobre em resíduo versus dieta líquida clara durante o preparo intestinal para colonoscopia: um estudo piloto controlado e randomizado
Fonte: J. coloproctol. (Rio J., Impr.);39(1):62-66, Jan.-Mar. 2019. tab, graf.
Idioma: en.
Resumo: ABSTRACT Objectives: Conventional bowel preparation for colonoscopy confines patient to clear liquid diet the day before and such non-nutritive dietary regimen often caused discomfort and hunger. The purpose of this study is to determine the feasibility of feeding patient with low-residue, lactose-free semi-elemental enteral formula (PEPTAMEN®) compare to conventional clear liquid diet during bowel preparation before colonoscopy. Methods: This was a randomised, endoscopist-blinded study. Patients were randomised into two groups, those receiving oral PEPTAMEN® and mechanical bowel preparation (A) and those receiving clear liquid while undergoing mechanical bowel preparation (B). Documentation was made with regard to the type of bowel cleansing agents used, completeness of the colonoscopy, cleanliness quality score, and hunger score. Results: A total of 97 patients were included in the study, A = 48 and B = 49. Eight patients, who were not compliant to the bowel-cleansing agent or had an incomplete colonoscopic examination, were excluded from the study. In terms of the overall cleanliness score, no statistical significant difference was seen (p = 0.25) between the two groups, A (fair or poor 37.5%, good or excellent 62.5%) and B (fair or poor 49%, good or excellent 51%) whereas the hunger score showed a significant difference (p = 0.016), A (no hunger 41.7%, slight hunger 12.5%, hungry 12.5%) and B (no hunger 24.5%, slight hunger 38.8%, hungry 36.7%). Conclusions: These data suggest that the addition of oral PEPTAMEN® as part of the bowel preparation regimen did not significantly alter the luminal cleanliness score during colonoscopy while alleviating hunger.

RESUMO Objetivo: A preparação intestinal convencional para a colonoscopia confina o paciente à dieta líquida clara no dia anterior; esse regime dietético não nutritivo frequentemente causa desconforto e fome. O presente estudo teve como objetivo determinar a viabilidade de alimentar o paciente com fórmula enteral semielementar sem lactose e pobre em resíduos (PEPTAMEN®) em comparação com a dieta líquida clara convencional no preparo intestinal para colonoscopia. Métodos: Este foi um estudo randomizado no qual o endoscopista foi cego quanto ao tipo de preparo. Os pacientes foram randomizados em dois grupos: aqueles que receberam PEPTAMEN® oral e preparo intestinal mecânico (A) e aqueles que receberam dieta líquida clara e preparo intestinal mecânico (B). Os pacientes foram avaliados quanto ao tipo de agente de limpeza intestinal utilizado, a completude da colonoscopia, o escore de qualidade de limpeza e o escore de fome. Resultados: Um total de 97 pacientes foram incluídos no estudo, 48 no grupo A e 49 no grupo B. Oito pacientes foram excluídos por não aderirem ao agente de limpeza intestinal ou apresentarem um exame incompleto de colonoscopia. Quanto ao escore geral de limpeza, não se observou diferença estatisticamente significativa (p = 0,25) entre os grupos A (resultado regular ou ruim, 37,5%; bom ou excelente, 62,5%) e B (resultado regular ou ruim, 49%; bom ou excelente, 51%). Por outro lado, o escore de fome apresentou diferença significativa (p = 0,016) entre os grupos A (sem fome, 41,7%; fome leve, 12,5%; fome, 12,5%) e B (sem fome, 24,5%; fome leve, 38,8%; fome, 36,7%). Conclusões: Os dados sugerem que a adição de PEPTAMEN® oral como parte do regime de preparo intestinal não altera significativamente o escore de limpeza luminal durante a colonoscopia, mas alivia a fome.
Descritores: Alimentos Formulados
Colonoscopia/métodos
-Peptídeos/administração & dosagem
Catárticos/administração & dosagem
Protocolos Clínicos
Limites: Humanos
Responsável: BR545.3 - Biblioteca ICBS



página 1 de 36 ir para página                         
   


Refinar a pesquisa
  Base de dados : Formulário avançado   

    Pesquisar no campo  
1  
2
3
 
           



Search engine: iAH v2.6 powered by WWWISIS

BIREME/OPAS/OMS - Centro Latino-Americano e do Caribe de Informação em Ciências da Saúde