Base de dados : LILACS
Pesquisa : D12.644.050 [Categoria DeCS]
Referências encontradas : 46 [refinar]
Mostrando: 1 .. 10   no formato [Detalhado]

página 1 de 5 ir para página              

  1 / 46 LILACS  
              next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Cuba
Texto completo
Texto completo
Id: biblio-1093562 LILACS-Express
Autor: González-García, Melaine; Ständker, Ludger; Otero-González, Anselmo Jesús.
Título: Antimicrobial peptides in multiresistant respiratory infections / Péptidos antimicrobianos en infecciones respiratorias multiresistentes
Fonte: Rev. cuba. med. trop;71(2):e343, mayo.-ago. 2019. tab, graf.
Idioma: en.
Resumo: ABSTRACT Antimicrobial peptides are small cationic molecules present in almost all living organisms. They show direct or indirect (immunomodulation) activity in a wide range of pathogenic microorganisms as members of the humoral arsenal of innate immunity. In mammals they play a significant role in respiratory airways. The most abundant antimicrobial peptides in the respiratory tract of mammals are lysozymes, lactoferrin, histatins, defensins and cathelicidins. Respiratory and pulmonary infections are combated, primarily, by antimicrobial peptides like LL-37 against Gram-negative bacteria, histatin 5 against Candida albicans and human peptides from neutrophils against adenovirus, influenza and parainfluenza. This paper provides a review of the most important antimicrobial peptides in the respiratory tract and their use in the search for new effective agents against microorganisms that cause respiratory infections based on information published in MedLine, the Web of Science and Scopus in recent years.

RESUMEN Los péptidos antimicrobianos son pequeñas moléculas catiónicas presentes en casi todos los organismos vivos. Muestran actividad directa o indirecta (inmunomodulación) en una amplia gama de microorganismos patógenos como miembros del arsenal humoral de la inmunidad innata. En los mamíferos juegan un papel importante en las vías respiratorias. Los péptidos antimicrobianos más abundantes en el tracto respiratorio son lisozima, lactoferrina, histatinas, defensinas y catelicidinas. Las infecciones respiratorias y pulmonares son combatidas, principalmente, por péptidos antimicrobianos como LL-37 contra bacterias gramnegativas, histatina 5 contra Candida albicans y péptidos humanos de neutrófilos contra adenovirus, influenza y parainfluenza. Este artículo proporciona una revisión sobre los péptidos antimicrobianos más importantes en el tracto respiratorio y su empleo en la búsqueda de nuevos agentes eficaces contra microorganismos causantes de infecciones respiratorias teniendo en cuenta la información publicada al respecto en MedLine, Web of Science y Scopus en los últimos años.
Descritores: Resistência Microbiana a Medicamentos
Peptídeos Catiônicos Antimicrobianos/uso terapêutico
Limites: Humanos
Masculino
Feminino
Tipo de Publ: Revisão
Responsável: CU1.1 - Biblioteca Médica Nacional


  2 / 46 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-888148
Autor: Karadag, Remzi; Bayram, Nurettin; Oguztuzun, Serpil; Bayramlar, Huseyin; Bozer, Busra; Simsek, Gulcin; Rapuano, Christopher J.
Título: An investigation of human beta-defensins and cathelicidin expression in patients with pterygium / Uma investigação da expressão de beta-defensinas humanas e de catelidicina em pacientes com pterígio
Fonte: Arq. bras. oftalmol;80(5):277-280, Sept.-Oct. 2017. tab, graf.
Idioma: en.
Resumo: ABSTRACT Purpose: To investigate human beta-defensins (HBDs) and cathelicidin LL-37 (LL-37) expressions in patients with pterygium. Methods: In this retrospective consecutive case series, 26 pterygium specimens and 15 normal conjunctival specimens of 15 control subjects were in vestigated. Expressions of HBD-1, HBD-2, HBD-3, and LL-37 were assessed using immuno histochemical staining. A brown color in the cytoplasm and/or nuclei of epithelial cells indicated positive staining for HBDs and LL-37. For each antibody, the intensity of the reaction (negative [-], weak [1+], moderate [2+], or strong [3+]) was determined to describe the immunoreactions. Results: The median age was 52 years in both groups. There were no significant differences in age and sex between the groups (p=0.583, p=0.355, respectively). Of the 26 pterygium specimens, 15 (57.7%) (14 weak, 1 moderate staining) showed HBD-2 expression, which was not observed in any of the control specimens. One (3.8%) pterygium and one (6.7%) control specimen demonstrated weak staining for HBD-3. HBD-2 expression was significantly higher in the pterygium specimens than in the controls (p=0.002). None of the tissue specimens had positive staining for HBD-1 or LL-37 in either group (both; p=1.00). Conclusions: HBD-2 expression was higher in pterygium specimens than in the controls. HBD-2 expression that might be stimulated by inflammatory cytokines may be related to inflammation and fibrovascular proliferation and may play a role in pterygium pathogenesis.

RESUMO Objetivo: Investigar as expressões beta defensinas humanas (HBD) e catelicidina em pacientes com pterígio. Métodos: Nesta série de casos retrospectivos consecutivos, 26 espécimes de pterígio e 15 espécimes conjuntivais normais de 15 indivíduos controle foram investigados. As expressões de HBD-1, HBD-2, HBD-3 e catelicidina (LL-37) foram avaliadas por coloração imuno-histoquímica. Uma cor castanha no citoplasma ou nos núcleos de células epiteliais foi definida como coloração positiva para HBDs e LL-37. Para cada anticorpo foi determinada a intensidade da reação (negativo [-], fraco [1+], moderado [2+] ou forte [3+]) para descrever as imunoreações. Resultados: A idade média foi de 52 anos em ambos os grupos. Não houve diferença significativa entre os grupos em termos de idade e sexo (p=0,583, p=0,355, respectivamente). Das 26 amostras de pterígio, 15 (57,7%) (14 fracas e 1 moderada) demonstraram a expressão de HBD-2 enquanto não foi encontrada em nenhum dos espécimes de controlo. Um dos pterígios (3,8%) e um dos espécimes de controlo (6,7%) demonstraram fraca coloração para HBD-3. A expressão de HBD-2 foi significati vamente maior nos espécimes de pterígio do que nos controles (p=0,002). Nenhum dos espécimes de tecido apresentou coloração positiva para HBD-1 ou LL-37 em ambos os grupos (ambos p=1,00). Conclusão: Encontramos aumento da expressão de HBD-2 em espécimes de pte rígio em relação aos controles. A expressão de HBD-2 que pode ser estimulada por citocinas inflamatórias pode estar relacionada com inflamação e proliferação fibrovascular e pode desempenhar um papel na patogênese do pterígio.
Descritores: Pterígio/metabolismo
Peptídeos Catiônicos Antimicrobianos/análise
beta-Defensinas/análise
-Valores de Referência
Biópsia
Imuno-Histoquímica
Estudos de Casos e Controles
Estudos Retrospectivos
Estatísticas não Paramétricas
Túnica Conjuntiva/química
Limites: Humanos
Masculino
Feminino
Adulto
Pessoa de Meia-Idade
Idoso
Responsável: BR1.1 - BIREME


  3 / 46 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-659757
Autor: Souza, Vânia Nieto Brito de; Malaspina, Tatiana Salles de Souza; Campanelli, Ana Paula; Ghidella, Cássio; Ura, Somei; Dalpino, Dirceu; Nascimento, Dejair Caitano do; Latini, Ana Carla Pereira.
Título: Increased hepcidin expression in multibacillary leprosy
Fonte: Mem. Inst. Oswaldo Cruz;107(supl.1):183-189, Dec. 2012. ilus.
Idioma: en.
Projeto: CNPq; . Fundação Paulista contra a Hanseníase.
Resumo: Iron is essential for all organisms and its availability can control the growth of microorganisms; therefore, we examined the role of iron metabolism in multibacillary (MB) leprosy, focusing on the involvement of hepcidin. Erythrograms, iron metabolism parameters, pro-inflammatory cytokines and urinary hepcidin levels were evaluated in patients with MB and matched control subjects. Hepcidin expression in MB lesions was evaluated by quantitative polymerase chain reaction. The expression of ferroportin and hepcidin was evaluated by immunofluorescence in paucibacillary and MB lesions. Analysis of hepcidin protein levels in urine and of hepcidin mRNA and protein levels in leprosy lesions and skin biopsies from healthy control subjects showed elevated hepcidin levels in MB patients. Decreases in haematologic parameters and total iron binding capacity were observed in patients with MB leprosy. Moreover, interleukin-1 beta, ferritin, soluble transferrin receptor and soluble transferrin receptor/log ferritin index values were increased in leprosy patients. Hepcidin was elevated in lepromatous lesions, whereas ferroportin was more abundant in tuberculoid lesions. In addition, hepcidin and ferroportin were not colocalised in the biopsies from leprosy lesions. Anaemia was not commonly observed in patients with MB; however, the observed changes in haematologic parameters indicating altered iron metabolism appeared to result from a mixture of anaemia of inflammation and iron deficiency. Thus, iron sequestration inside host cells might play a role in leprosy by providing an optimal environment for the bacillus.
Descritores: Peptídeos Catiônicos Antimicrobianos/urina
Citocinas/sangue
Ferro/metabolismo
Hanseníase Multibacilar/sangue
Hanseníase Multibacilar/urina
-Anemia/microbiologia
Estudos de Casos e Controles
Progressão da Doença
Imunofluorescência
Homeopatia
Inflamação/microbiologia
Hanseníase Multibacilar/complicações
Reação em Cadeia da Polimerase
Limites: Humanos
Tipo de Publ: Research Support, Non-U.S. Gov't
Responsável: BR1.1 - BIREME


  4 / 46 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-1019982
Autor: Zhu, Chuanan; Zhou, Yingfan; Zhu, Jiabin; Liu, Ye; Sun, Mengyi.
Título: Proteína 3 contendo um domínio NACHT, porção C-terminal rica em repetições de leucina e de domínio pirina e LL-37: valor prognóstico de novos biomarcadores em pneumonia adquirida na comunidade / NACHT, LRR, and PYD domains-containing Protein 3 and LL-37: prognostic value of new biomarkers in community-acquired pneumonia
Fonte: J. bras. pneumol;45(4):e20190001, 2019. tab, graf.
Idioma: pt.
Resumo: RESUMO Objetivo Este estudo teve como objetivo determinar os níveis séricos de proteína 3 contendo um domínio NACHT, porção C-terminal rica em repetições de leucina e de domínio pirina (NLRP3) e catelicidina LL-37, bem como investigar sua importância prognóstica em pneumonia adquirida na comunidade (PAC). Métodos Este estudo prospectivo incluiu 76 pacientes com PAC. Foram obtidos dados demográficos e características clínicas. Os níveis séricos de NLRP3 e LL-37 foram determinados por meio do teste ELISA. A correlação entre NLRP3 e LL-37 foi estimada por intermédio da análise de Spearman. A associação entre NLRP3 e LL-37 com 30 dias de taxa de sobrevida e de mortalidade foi avaliada pela curva de Kaplan-Meier e análise de regressão logística. Resultados Os níveis séricos de NLRP3 estavam elevados, enquanto os níveis de LL-37 apresentaram redução significativa em pacientes com PAC grave. Observou-se correlação significativa entre os níveis séricos de NLRP3 e LL-37 em pacientes com PAC. Pacientes com níveis elevados de NLRP3 e níveis reduzidos de LL-37 exibiram maior taxa de sobrevida em 30 dias e de mortalidade quando comparados com aqueles com níveis inferiores de NLRP3 e LL-37. Conclusões Pacientes com PAC grave tendem a apresentar níveis séricos elevados de NLRP3 e níveis reduzidos de LL-37, o que pode ser utilizado como um potencial biomarcador prognóstico.

ABSTRACT Objective This study aimed to determine the serum levels of NACHT, Leucine-rich repeat (LRR), and Pyrin (PYD) domains-containing Protein 3 (NLRP3) and cathelicidin LL-37, and investigate their prognostic significance in community-acquired pneumonia (CAP). Methods The sample of this prospective study was composed of 76 consecutive patients with CAP. Demographic data and clinical characteristics were collected. Serum levels of NLRP3 and LL-37 were determined by ELISA. Spearman's analysis was used to evaluate the correlation between NLRP3 and LL-37. Association of NLRP3 and LL-37 with 30-day survival and mortality rates was assessed using the Kaplan-Meier curve and logistic regression analysis. Results Serum NLRP3 significantly increased whereas serum LL-37 significantly decreased in patients with severe CAP. Significant correlation was observed between serum NLRP3 and LL-37 in CAP patients. Patients with higher levels of NLRP3 and lower levels of LL-37 showed lower 30-day survival rate and higher mortality compared with those with lower NLRP3 and higher LL-37 levels. Conclusion Severe CAP patients tend to present higher serum NLRP3 and lower serum LL-37, which might serve as potential biomarkers for CAP prognosis.
Descritores: Pneumonia/sangue
Proteínas/análise
Infecções Comunitárias Adquiridas/sangue
Peptídeos Catiônicos Antimicrobianos/sangue
Proteína 3 que Contém Domínio de Pirina da Família NLR/sangue
Pirina/sangue
-Pneumonia/mortalidade
Biomarcadores/sangue
Estudos de Casos e Controles
Modelos Logísticos
Análise Multivariada
Valor Preditivo dos Testes
Estudos Prospectivos
Infecções Comunitárias Adquiridas/mortalidade
Estimativa de Kaplan-Meier
Limites: Humanos
Masculino
Feminino
Pessoa de Meia-Idade
Idoso
Responsável: BR1.1 - BIREME


  5 / 46 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-974341
Autor: Kandil, Mona; Khalil, Gihane; El-Attar, Eman; Shehata, Gihan; Hassan, Salwa.
Título: Accuracy of heparin binding protein: as a new marker in prediction of acute bacterial meningitis
Fonte: Braz. j. microbiol;49(supl.1):213-219, 2018. tab, graf.
Idioma: en.
Resumo: ABSTRACT Background: Cerebrospinal fluid bacterial culture is the gold-standard for confirmation of acute bacterial meningitis, but many cases are not culture confirmed. Antibiotics reduce the chance of a microbiological diagnosis. Objective to evaluate efficacy of Heparin-binding protein in diagnosis of bacterial meningitis. Patients: 30 patients diagnosed with acute bacterial meningitis, 30 viral meningitis, and 30 subjects with normal CSF findings. Design: Diagnosis was based on history, clinical criteria, CSF examination, latex agglutination & culture, and sensitivities and response to therapy. HBP was measured using enzyme-linked immunosorbent technique in both serum & CSF. Results: Cerebrospinal fluid HBP levels averaged 0.82 ± 0.3 ng/mL in controls, 3.3 ± 1.7 ng/mL in viral and 174.8 ± 46.7 ng/mL in bacterial meningitis. Mean serum level was 0.84 ± 0.3 ng/mL in the controls, 3.7 ± 1.9 ng/mL in viral, and 192.2 ± 56.6 ng/mL in bacterial meningitis. Both HBP levels were significantly higher in patients with bacterial meningitis. Cut-offs of 56.7 ng/ml and 45.3 ng/ml in cerebrospinal fluid & serum showed 100% overall accuracy. Even in patients who received prior antibiotics, remained elevated. Conclusion: Serum Heparin-binding protein serves as a non-invasive potential marker of acute bacterial meningitis even in partially treated cases.
Descritores: Proteínas Sanguíneas/líquido cefalorraquidiano
Heparina/metabolismo
Proteínas de Transporte/líquido cefalorraquidiano
Proteínas de Transporte/sangue
Meningites Bacterianas/diagnóstico
Peptídeos Catiônicos Antimicrobianos/líquido cefalorraquidiano
Peptídeos Catiônicos Antimicrobianos/sangue
-Biomarcadores/líquido cefalorraquidiano
Biomarcadores/sangue
Estudos Transversais
Meningites Bacterianas/líquido cefalorraquidiano
Meningites Bacterianas/microbiologia
Meningites Bacterianas/sangue
Pessoa de Meia-Idade
Limites: Humanos
Masculino
Feminino
Lactente
Pré-Escolar
Criança
Adolescente
Adulto
Adulto Jovem
Responsável: BR1.1 - BIREME


  6 / 46 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
Id: biblio-1051133
Autor: Caiaffa, Karina Sampaio.
Título: Efeito isolado ou combinado de flavonoides e peptídeos catiônicos sobre biofilme endodôntico e sua influência na viabilidade celular, capacidade de migração e inibição de citocinas em fibroblastos / Effect of flavonoids and cationic peptides, alone or in combination, on endodontic biofilm and their influence on cell viability, migration capacity and inhibition of cytokines in fibroblasts.
Fonte: Araçatuba; s.n; 2019. 114 p. tab, graf, ilus.
Idioma: en; pt.
Tese: Apresentada a Universidade Estadual Paulista "Julio de Mesquita Filho". Faculdade de Odontologia de Araçatuba para obtenção do grau de Doutor.
Resumo: Este trabalho foi dividido em dois capítulos que objetivou avaliar: 1) o efeito isolado ou combinado do flavonoide epigallocatechin-3-gallate (EGCG) em associação com o peptídeo LL-37 e seu análogo KR-12-a5 sobre a viabilidade celular de fibroblastos e sobre cultura planctônica, biofilme simples, dual-espécies e túbulos dentináios e 2) as interações sinérgicas do EGCG e proantocianidina do oxicoco (A-type cranberry proanthocyanidins, AC-PAC), quando usado em combinação com LL-37 ou KR-12-a5 sobre a viabilidade celular, a capacidade de migração e inibição das citocinas em cultura de fibroblastos (HGF-1), quando estimuladas ou não pelo lipopolissacarídeo de A. actinomycetencomitans (LPS). No capítulo 1, a concentração inibitória mínima (MIC), a concentração bactericida mínima (MBC) e concentração inibitória fracionária (FIC) de EGCG, LL-37 e KR-12-a5 foram determinadas a partir de valores decrescentes dos compostos por meio dos métodos de microdiluição e checkerboard contra Streptococcus mutans, Enterococcus faecalis, Actinomyces israelii e Fusobacterium nucleatum após 24 horas de tratamento. Fibroblastos da linhagem L-929 foram expostos a combinações de EGCG com peptídeos em diferentes concentrações e o metabolismo celular avaliado por ensaios de MTT. Os compostos com melhor efeito antimicrobiano e citotóxico foram avaliados por 24-36h, isoladamente ou em combinação, em biofilmes individuais ou biofilmes de dual-espécies com E. faecalis formados em placas de poliestireno por 48h por meio de contagem bacteriana. Os biofilmes de E. faecalis também foram cultivados em túbulos dentinários por 2 semanas, tratados com EGCG, KR-12-a5 e EGCG + KR-12-a5 e a porcentagem de células mortas foi determinada pela análise de imagens usando Microscopia Confocal. No capítulo 2, a linhagem celular de fibroblastos gengivais humanos primários HGF-1 foi pré-tratada durante 2 h com EGCG ou AC-PAC a 25 e 12,5 µg / mL, LL-37 ou KR-12-a5 a 0,06 e 0,03 µM ou com uma combinação de EGCG + ACPAC; AC-PAC + KR-12-a5; AC-PAC + LL-37; EGCG + KR-12-a5 ou EGCG + LL-37, nas mesmas concentrações. As culturas celulares foram então estimuladas com 50 µg/mL de LPS por 24-48h. A viabilidade celular e migração foram analisadas usando ensaios colorimétricos e fluorescentes, respectivamente. A quantificação de citocinas foi determinada por ensaios multiplex ELISA. Os resultados mostraram que em condições planctônicas, EGCG + KR-12-a5 apresentaram efeito sinérgico ou aditivo contra todas as bactérias testadas, com FIC menor que os valores de MIC obtidos pelos compostos isolados. As combinações de EGCG e peptídeos testados não foram tóxicas para os fibroblastos, uma vez que o crescimento celular foi superior a 70%. Em condições de biofilme simples, EGCG + KR-12-a5 eliminou S. mutans e A. israelii e reduziu E. faecalis e F. nucleatum. Para biofilmes de duas espécies, quando E. faecalis foi combinado com S. mutans, EGCG + KR-12-a5 teve efeito sinérgico eliminando S. mutans e reduzindo estatisticamente as contagens de E. faecalis. Em biofilmes associando E. faecalis e A. israelii ou F. nucleatum, EGCG + KR-12-a5 eliminaram E. faecalis e promoveram redução de A. israelii e F. nucleatum, embora não tenha sido observada diferença estatística entre os compostos. EGCG + KR-12-a5 reduziu mais de 80% dos biofilmes de E. faecalis nos túbulos dentinários. Dentre os grupos experimentais estudados, o EGCG, principalmente a 25 e 12,5 µg/mL estimulou o crescimento de fibroblastos, protegendo-os dos efeitos do LPS. Efeito sinérgico entre EGCG + AC-PAC, EGCG + LL-37 e EGCG + KR-12-a5 no metabolismo celular também foi observado na presença de LPS. Combinações do EGCG com AC-PAC ou KR-12-a5 e AC-PAC com LL-37 foram capazes de aumentar estatisticamente a migração celular. EGCG, AC-PAC, LL-37 e KR-12-a5 promoveram a redução de citocinas individualmente ou em combinação (EGCG + AC-PAC e EGCG + KR12-a5) mais especificamente para IL-6, IL-8, GM- CSF e TNF-α. Conclui-se que a associação de EGCG e KR-12-a5 é citocompatível e promove um efeito sinérgico contra bactérias associadas a infecções endodônticas, sob condições planctônicas e de biofilme. O EGCG, isoladamente ou associado ao AC-PAC e ao KR-12-a5, aumenta a viabilidade e migração celular, bem como a inibição de citocinas por fibroblastos estimulados por LPS. A associação de EGCG com KR-12-a5 poderia ser uma opção de princípio ativo em medicações para fins endodônticos(AU)

This study was divided in two chapters that aimed to evaluate: 1) the effect of flavonoid epigallocatechin-3-gallate (EGCG), cationic peptide LL-37 peptide and its analogue KR12-a5, alone or in combination, on fibroblast cell viability and on bacteria in planktonic and single/dual-species biofilms/dentin tubules; 2) the synergistic interactions of EGCG and cranberry proanthocyanidins (A-type cranberry proanthocyanidins, AC-PAC), when used in combination with LL-37 or KR-12-a5 on cell viability, the ability to induce cell migration and inhibit cytokines in culture of fibroblasts (HGF-1) when stimulated or not by the lipopolysaccharide of A. actinomycetencomitans (LPS). For the chapter 1, Minimum inhibitory concentration (MIC), minimum bactericidal concentration (MBC) and fractional inhibitory concentration (FIC) of EGCG, LL-37 and KR-12-a5 were determined from decreasing values of the compounds by Streptococcus mutans, Enterococcus faecalis, Actinomyces israelii and Fusobacterium nucleatum against microdilution and checkerboard after 24 hours of treatment. L-929 fibroblasts were exposed to combinations of EGCG with peptides at different concentrations and cell metabolism assessed by MTT assays. The compounds if the best antimicrobial and cytotoxic effect were also evaluated for 24-36h, alone or in combination, in 48h singleor dual-species biofilms with E. faecalis formed on polystyrene plates by bacterial counting. E. faecalis biofilms were also cultured in dentin tubules for 2 weeks and treated with EGCG, KR-12-a5 and EGCG + KR-12-a5 to determine the percentage of dead cells by analysis of images using Confocal Microscopy. For the chaper 2, primary human gingival fibroblast HGF-1 cell line was pretreated for 2 h with either EGCG or AC-PAC at 25 and 12.5 µg/mL, LL-37 or KR-12-a5 at 0.03 and 0.06 µM or with a combination of EGCG + AC-PAC; AC-PAC + KR-12-a5; AC-PAC + LL-37; EGCG + KR-12-a5 or EGCG + LL37, at the same concentrations. Cell cultures were then stimulated with 50 µg/mL LPS for 24-48h. Cell viability and migration were analyzed using colorimetric and fluorescent assays, respectively. Quantification of cytokines was determined by multiplex ELISA assays. The results show that in planktonic conditions, EGCG + KR-12- a5 showed a synergistic or additive effect against all the bacteria tested, with FIC lower than the MIC values obtained by the compounds alone. Combinations of EGCG and peptides tested were not toxic to fibroblasts, since cell growth was higher than 70%. Under single biofilm conditions, EGCG + KR-12-a5 eliminated S. mutans and A. israelii and reduced E. faecalis and F. nucleatum. For dual- species biofilms, when E. faecalis was combined with S. mutans, EGCG + KR-12-a5 had a synergistic effect by eliminating S. mutans and statistically reducing E. faecalis counts. In biofilms associated with E. faecalis and A. israelii or F. nucleatum, EGCG + KR-12-a5 eliminated E. faecalis and promoted reduction of A. israelii and F. nucleatum, although no statistical difference was observed between the compounds. EGCG + KR-12-a5 reduced more than 80% of the E. faecalis biofilms in the dentin tubules. Among the experimental groups studied, EGCG, mainly at 25 and 12.5 µg/mL stimulated the growth of fibroblasts, protecting them from the effects of LPS. Synergistic effect between EGCG + AC-PAC, EGCG + LL-37 and EGCG + KR12-a5 on cell metabolism was also observed in the presence of LPS. Combinations of EGCG with AC-PAC or KR-12-a5 and AC-PAC with LL-37 were able to increase statistically cell migration. EGCG, AC-PAC, LL-37 and KR-12-α5 promoted cytokine reduction individually or in combination (EGCG + AC-PAC and EGCG + KR-12-a5) more specifically for IL-6, IL-8, GM-CSF and TNF-α. The association of EGCG and KR-12-a5 was cytocompatible and promoted a synergistic effect against bacteria associated with endodontic infections under planktonic and biofilm conditions. EGCG, alone or in combination with AC-PAC and KR-12-a5, increases cell viability and migration, as well as inhibition of cytokines by LPS-stimulated fibroblasts. The association of EGCG with KR12-a5 could be an option as active principle for medications to be used for endodontic purposes(AU)
Descritores: Flavonoides
Biofilmes
Peptídeos Catiônicos Antimicrobianos
-Citocinas
Fibroblastos
Responsável: BR186.1 - Biblioteca Honório Monteiro
BR186.1


  7 / 46 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-773437
Autor: Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang.
Título: Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis
Fonte: J. venom. anim. toxins incl. trop. dis;22:5, 2016. tab, graf, ilus.
Idioma: en.
Projeto: Chinese National Natural Science Foundation; . Research Foundation of Kunming University; . Research Foundation of Kunming University.
Resumo: Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)
Descritores: Peptídeos/isolamento & purificação
Análise de Sequência de DNA/métodos
Baratas/imunologia
Peptídeos Catiônicos Antimicrobianos/química
-Sequência de Aminoácidos
Anti-Infecciosos/análise
Limites: Animais
Responsável: BR1.1 - BIREME


  8 / 46 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
Id: biblio-911426
Autor: Aida, Kelly Limi.
Título: Efeito microbiológico e citotóxico de sistemas nanoestruturados bioadesivos contendo fragmentos de peptídeos / Microbiological and citotoxicity effect of nanostructured bioadhesive system containing peptide fragments.
Fonte: Araçatuba; s.n; 2017. 83 p. graf, tab, ilus.
Idioma: en; pt.
Tese: Apresentada a Universidade Estadual Paulista "Julio de Mesquita Filho". Faculdade de Odontologia de Araçatuba para obtenção do grau de Doutor.
Resumo: O uso de agentes antimicrobianos naturais que reduzam a adesão e proliferação de S. mutans no biofilme poderia ser uma estratégia interessante para o controle da cárie dentária. No entanto, a estabilidade química e física de alguns desses agentes, como os peptídeos catiônicos antimicrobianos e fragmentos de peptídeos, pode ser comprometida por fatores externos, como temperatura e pH, reduzindo sua ação antimicrobiana. Com isso, os objetivos deste estudo foram desenvolver e caracterizar sistemas de liberação de fármaco nanoestruturados bioadesivos para a incorporação dos fragmentos peptídicos D1-23 e P1025 e avaliar seu efeito citotóxico e atividade contra biofilme de S. mutans. A primeira formulação (F1), composta de ácido oleico, polyoxypropylene-(5)-polyoxyethylene-(20)-cetyl alcohol (PPCA), Carbopol® 974P e Carbopol® 971P, foi analisada por microscopia de luz polarizada (MLP), reologia e bioadesão in vitro. A concentração inibitória mínima (CIM) e concentração bactericida mínima (CBM) de D1-23 foram determinadas contra S. mutans para posterior avaliação da atividade sobre biofilme formado após 4h e 24h de tratamento. A segunda formulação (F2) foi selecionada a partir de três diferentes concentrações de ácido oleico, PPCA e Carbopol® 974P. Cada formulação foi analisada por MLP, espalhamento de raios x a baixo ângulo (SAXS), reologia e bioadesão. CIM e CBM de P1025 sobre S. mutans e seu efeito quando incorporado ou não em F2 sobre biofilme de S. mutans em formação foram analisados. A citotoxicidade em células epiteliais HaCat foi avaliada para os dois sistemas líquido cristalino (SLC) usando testes de MTT. Análise descritiva foi realizada para os dados dos ensaios de caracterização e para os ensaios microbiológicos e citotóxicos os dados foram submetidos aos testes de ANOVA/Tukey ou Kruskall-Wallis/Mann-Whitney U (p<0.05). Os resultados indicaram que F1 apresentou características de SLC com alta viscosidade e bioadesão. CIM e CBM de D1-23 foram de 15,60 e 31,25µg/mL, respectivamente. D1-23 incorporado em F1 apresentou melhores resultados contra biofilme de S. mutans que quando em solução, após 24h de tratamento. F2 apresentou melhores propriedades reológicas e força bioadesiva comparada aos demais sistemas, caracterizando um SLC. P1025 teve somente efeito inibitório sobre S. mutans (CIM=0.25 mg/mL). O efeito antibiofilme de P1025 incorporado em F2 foi observado após 24h de tratamento, principalmente quando aplicado na fase de adesão. Ambos os SLC contendo D1-23 e P1025 não apresentaram toxicidade sobre as células epiteliais, nas condições de tempo e concentrações avaliadas. A incorporação de peptídeos em SLC bioadesivos nanoestruturados aumenta suas propriedades antimicrobianas, podendo ser uma interessante estratégia para a prevenção da cárie dentária(AU)

The use of natural antimicrobial agents for reducing the adhesion and proliferation of S. mutans in the biofilm could be an interesting strategy for the control of dental caries. However, the chemical and physical stability of some natural antimicrobials, such as cationic antimicrobial peptides and peptide fragments, can be compromised by external factors such as temperature and pH, reducing their antimicrobial action. Thus, the objectives of this study were to develop and characterize nanostructured bioadhesive drug delivery systems for the incorporation of D1-23 and P1025 peptide fragments and to evaluate their citotoxicy and activity against S. mutans biofilm. The first formulation (F1) was composed of oleic acid, polyoxypropylene- (5) -polyoxyethylene- (20) - cetyl alcohol (PPCA), Carbopol® 974P and Carbopol® 971P and analyzed by polarized light microscopy (PLM), rheology and in vitro bioadhesion. Minimum inhibitory concentration (MIC) and minimal bacterial concentration (MBC) of D1-23 were determined against S. mutans for further evaluation of activity against S. mutans biofilm after 4h and 24h of treatment. The second formulation was selected from three different concentrations of oleic acid, PPCA and Carbopol® 974P. Each formulation was analyzed by PLM, small-angle x-ray scattering (SAXS), rheology and bioadhesion. MIC and MBC of P1025 were determined against S. mutans. Thus, P1025 was incorporated in the best formulation (F2). The effect of P1025 incorporated or not into F2 on S. mutans biofilm formation was analyzed. Cytotoxicity in HaCat epithelial cells for both formulations was evaluated using MTT assays. Descriptive analysis was performed for the characterization assays and data from microbiological and cytotoxic assays were submitted to ANOVA / Tukey or Kruskall-Wallis / Mann-Whitney U (p<0.05). The results indicated that F1 presented characteristics of liquid-crystalline type system (LCS) with high viscosity and bioadhesion. The MIC and MBC of D1-23 were 15.60 and 31.25µg / mL, respectively. D1-23 incorporated in F1 showed better results than D1-23 in solution against S. mutans biofilm after 24h. F2 had better rheological properties and bioadhesive strength compared to other systems analyzed and characteristics of LCS. P1025 had only inhibitory effect against S. mutans (MIC=0.25mg/mL). The antibiofilm effect of P1025 incorporated into F2 was observed after 24h of treatment, mainly when applied in surface-bound salivary phase. Both LCS had no toxicity on epithelial cells, considering time and concentrations tested. The incorporation of peptides in nanostructured bioadhesive LCS increased their antimicrobial properties and could be an interesting strategy for caries prevention(AU)
Descritores: Peptídeos Catiônicos Antimicrobianos
Cárie Dentária
Streptococcus mutans
-Biofilmes
Sistemas de Liberação de Medicamentos
Responsável: BR186.1 - Biblioteca Honório Monteiro
BR186.1


  9 / 46 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-889176
Autor: Li, Li; Mu, Lan; Wang, Xiaojuan; Yu, Jingfeng; Hu, Ruiping; Li, Zhen.
Título: A novel expression vector for the secretion of abaecin in Bacillus subtilis
Fonte: Braz. j. microbiol;48(4):809-814, Oct.-Dec. 2017. graf.
Idioma: en.
Resumo: ABSTRACT This study aimed to describe a Bacillus subtilis expression system based on genetically modified B. subtilis. Abaecin, an antimicrobial peptide obtained from Apis mellifera, can enhance the effect of pore-forming peptides from other species on the inhibition of bacterial growth. For the exogenous expression, the abaecin gene was fused with a tobacco etch virus protease cleavage site, a promoter Pglv, and a mature beta-glucanase signal peptide. Also, a B. subtilis expression system was constructed. The recombinant abaecin gene was expressed and purified as a recombinant protein in the culture supernatant. The purified abaecin did not inhibit the growth of Escherichia coli strain K88. Cecropin A and hymenoptaecin exhibited potent bactericidal activities at concentrations of 1 and 1.5 µM. Combinatorial assays revealed that cecropin A and hymenoptaecin had sublethal concentrations of 0.3 and 0.5 µM. This potentiating functional interaction represents a promising therapeutic strategy. It provides an opportunity to address the rising threat of multidrug-resistant pathogens that are recalcitrant to conventional antibiotics.
Descritores: Peptídeos Catiônicos Antimicrobianos/genética
Peptídeos Catiônicos Antimicrobianos/metabolismo
Bacillus subtilis/genética
Vetores Genéticos/genética
Proteínas de Insetos/genética
Proteínas de Insetos/metabolismo
-Antibacterianos/isolamento & purificação
Antibacterianos/metabolismo
Antibacterianos/farmacologia
Peptídeos Catiônicos Antimicrobianos/isolamento & purificação
Peptídeos Catiônicos Antimicrobianos/farmacologia
Bacillus subtilis/metabolismo
Escherichia coli/efeitos dos fármacos
Escherichia coli/crescimento & desenvolvimento
Expressão Gênica
Vetores Genéticos/metabolismo
Proteínas de Insetos/isolamento & purificação
Proteínas de Insetos/farmacologia
Engenharia de Proteínas
Transporte Proteico
Proteínas Recombinantes/genética
Proteínas Recombinantes/isolamento & purificação
Proteínas Recombinantes/metabolismo
Proteínas Recombinantes/farmacologia
Responsável: BR1.1 - BIREME


  10 / 46 LILACS  
              first record previous record
seleciona
para imprimir
Fotocópia
Id: biblio-883519
Autor: Silva, Bruno Rocha da; Lima, Lia Vila Real; Paula, Dayrine Silveira de; Martins, Ricardo Souza.
Título: Peptídeos antimicrobianos como terapia complementar periodontal: uma análise da literatura / Antimicrobial peptides as periodontal complementary therapy: an analysis of literature
Fonte: ImplantNewsPerio;3(2):324-334, mar.-abr. 2018. ilus, tab.
Idioma: pt.
Resumo: Objetivo: realizar um levantamento sistemático da literatura no que tange ao uso de peptídeos antimicrobianos contra periodontopatógenos e indicar quais os peptídeos e micro-organismos mais estudados, com o objetivo final de traçar um perfil das publicações na área. Material e métodos: a busca por artigos ocorreu na base de dados Pubmed, com os seguintes critérios de inclusão: publicação nos últimos dez anos; palavras-chave "Antimicrobial Peptide" and "Periodontal" and "Bacteria", publicados em inglês e disponíveis gratuitamente na íntegra para leitura. Um total de dez artigos foram selecionados após o refinamento dos dados. Resultados: apesar do pequeno número de estudos encontrados, evidencia-se o potencial uso de peptídeos antimicrobianos no controle das principais bactérias periodontopatogênicas. Além disso, os peptídeos produzidos por células da mucosa oral (Defensinas, LL-37 e Histatinas), bem como os micro-organismos Porphyromonas gingivalis e Fusobacterium nucleatum, foram os mais estudados. Conclusão: é possível concluir que o uso de peptídeos antimicrobianos como potencial ferramenta no controle microbiano tem uma importância crescente, provavelmente devido à sua ampla aplicabilidade, mecanismos de ação e baixos índices de resistência. Contudo, estudos relacionados à sua toxicidade sobre células humanas, modo de aplicação e ensaios clínicos precisam ser realizados.

Objectives: to perform a systematic review of the literature regarding the use of antimicrobial peptides against periodontopathogens and indicate the most studied peptides and microorganisms, with the final objective of outlining a profile of publications in the area. Material and methods: the search for articles occurred in Pubmed database with the following inclusion criteria: publication in the last 10 years; Keywords "Antimicrobial Peptide" and "Periodontal" and "Bacteria", published in English and freely available for reading. Results: a total of 10 articles were selected after refi ning the data. Despite the small number of studies found, it is evident the potential use of antimicrobial peptides in the control of the main periodontopathogenic bacteria. In addition, the peptides produced by oral mucosa cells (Defensins, LL-37 and Histatins) as well as the microorganisms Porphyromonas gingivalis and Fusobacterium nucleatum were the most studied. Conclusion: it is possible to conclude that the use of antimicrobial peptides as a tool in microbial control is of increasing importance, probably due to their wide applicability, mechanisms of action and low resistance indices. However, studies related to its toxicity on human cells, mode of application and clinical trials still need to be performed.
Descritores: Peptídeos Catiônicos Antimicrobianos
Peptídeos Catiônicos Antimicrobianos/uso terapêutico
Biofilmes/crescimento & desenvolvimento
Doenças Periodontais
Tipo de Publ: Revisão
Responsável: BR510.1 - Biblioteca Central



página 1 de 5 ir para página              
   


Refinar a pesquisa
  Base de dados : Formulário avançado   

    Pesquisar no campo  
1  
2
3
 
           



Search engine: iAH v2.6 powered by WWWISIS

BIREME/OPAS/OMS - Centro Latino-Americano e do Caribe de Informação em Ciências da Saúde