Base de dados : LILACS
Pesquisa : G02.111.570.060 [Categoria DeCS]
Referências encontradas : 314 [refinar]
Mostrando: 1 .. 10   no formato [Detalhado]

página 1 de 32 ir para página                         

  1 / 314 LILACS  
              next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Angelo, Margareth
Riesco, Maria Luiza Gonzalez
Texto completo
Id: lil-731305
Autor: Fonseca, Rosa Maria Godoy Serpa da; Ângelo, Margareth; Fujimori, Elizabeth; Riesco, Maria Luiza Gonzalez.
Título: The Nursing Graduate Program at 40 Years: What Can We Commemorate? / Os 40 anos do PPGE: o que temos a comemorar? / Los 40 años del PPGE: ¿Qué tenemos para conmemorar?
Fonte: Rev. Esc. Enferm. USP;48(spe):1-6, 08/2014.
Idioma: en.
Descritores: Bioensaio/métodos
Catepsinas/metabolismo
Leucina/análogos & derivados
Proteínas Luminescentes/metabolismo
Lisossomos/metabolismo
-Sequência de Aminoácidos
Catepsina L
Catepsinas/antagonistas & inibidores
Cisteína Endopeptidases
Proteínas de Fluorescência Verde
Células HeLa
Concentração de Íons de Hidrogênio
Leucina/metabolismo
Dados de Sequência Molecular
Proteínas Recombinantes de Fusão/metabolismo
Espectrometria de Fluorescência
Limites: Humanos
Responsável: BR1.1 - BIREME


  2 / 314 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Merighi, Miriam Aparecida Barbosa
Texto completo
Id: lil-731286
Autor: Silva, Marcelo Henrique da; Jesus, Maria Cristina Pinto de; Merighi, Miriam Aparecida Barbosa; Oliveira, Deíse Moura de.
Título: Limits and possibilities experienced by nurses in the treatment of women with chronic venous ulcers / Límites y posibilidades vividas por enfermeras en el tratamiento de mujeres con úlcera venosa crónica / Limites e possibilidades vivenciados por enfermeiras no tratamento de mulheres 
com úlcera venosa crônica
Fonte: Rev. Esc. Enferm. USP;48(spe):53-58, 08/2014.
Idioma: en.
Resumo: Objective To understand the experiences and expectations of nurses in the treatment of women with chronic venous ulcers. Method Phenomenological research was based on Alfred Schütz, whose statements were obtained in January, 2012, through semi-structured interviews with seven nurses. Results The nurse reveals the difficulties presented by the woman in performing self-care, the perceived limitations in the treatment anchored in motivation, and the values and beliefs of women. It showed professional frustration because venous leg ulcer recurrence, lack of inputs, interdisciplinary work and training of nursing staff. There was an expected adherence to the treatment of women, and it emphasized the need for ongoing care, supported self-care and standard practices in treatment. Conclusion That treatment of chronic venous leg ulcers constitutes a challenge that requires collective investment, involving women, professionals, managers and health institutions. .

Objetivo Comprender las experiencias y expectativas de enfermeras en el tratamiento de mujeres con úlcera venosa crónica. Método Investigación fenomenológica fundamentada en Alfred Schutz, que buscó Se realizó entrevista semiestructurada con siete enfermeras, en enero del 2012. Resultados La enfermera revela dificultades presentadas por la mujer para realizar el autocuidado, percibe limitaciones en el tratamiento relacionadas con la desmotivación, los valores y las creencias de las mujeres. Refiere frustración profesional debido a la recidiva de la lesión, a la falta de insumos, al deficiente trabajo interdisciplinar y a la limitada capacitación del equipo de enfermeras. Espera la adhesión de la mujer al tratamiento y resalta la necesidad del cuidado continuo, del autocuidado apoyado y de estandarizar conductas de tratamiento. Conclusión El tratamiento de la úlcera venosa crónica es un desafío que requiere contribución colectiva, involucrando a las mujeres, a los profesionales, a los gestores y a las instituciones de salud. .

Objetivo Compreender as experiências e expectativas de enfermeiras no tratamento de mulheres com úlcera venosa crônica na Atenção Primária à Saúde. Método Pesquisa fundamentada na fenomenologia social de Alfred Schütz, com depoimentos obtidos em janeiro de 2012, por meio de entrevista semiestruturada com sete enfermeiras. Resultados As enfermeiras revelam dificuldades apresentadas pelas mulheres com úlcera venosa crônica para realizar o autocuidado, percebem limitações na terapêutica ancoradas na desmotivação e nos valores e crenças das mulheres. Referem frustração profissional em razão da recidiva da lesão, falta de insumos e tecnologia, de trabalho interdisciplinar e da capacitação da equipe de enfermagem. Esperam a adesão das mulheres ao tratamento e ressaltam a necessidade do cuidado contínuo, do autocuidado apoiado e da padronização de condutas no tratamento. Conclusão O tratamento da úlcera venosa crônica constitui-se em um desafio que requer investimento coletivo, envolvendo a mulher, os profissionais, os gestores e as instituições de saúde. .
Descritores: Proteínas de Caenorhabditis elegans/isolamento & purificação
Caenorhabditis elegans/metabolismo
Membrana Celular/metabolismo
Canais Iônicos/isolamento & purificação
Canais Iônicos/metabolismo
Proteínas do Tecido Nervoso/isolamento & purificação
Proteínas do Tecido Nervoso/metabolismo
Sistema Nervoso/metabolismo
Neurônios Aferentes/metabolismo
Sensação/genética
-Sequência de Aminoácidos/genética
Sequência de Bases/genética
Comportamento Animal/efeitos dos fármacos
Comportamento Animal/fisiologia
Proteínas de Caenorhabditis elegans/genética
Proteínas de Caenorhabditis elegans/metabolismo
Caenorhabditis elegans/citologia
Capsaicina/farmacologia
Compartimento Celular/genética
Membrana Celular/efeitos dos fármacos
Membrana Celular/ultraestrutura
Regulação da Expressão Gênica/fisiologia
Canais Iônicos/genética
Canais Iônicos/ultraestrutura
Dados de Sequência Molecular
Mutação/genética
Proteínas do Tecido Nervoso/genética
Proteínas do Tecido Nervoso/ultraestrutura
Sistema Nervoso/citologia
Sistema Nervoso/efeitos dos fármacos
Neurônios Aferentes/citologia
Neurônios Aferentes/efeitos dos fármacos
Dor/genética
Dor/metabolismo
Dor/fisiopatologia
Filogenia
Receptores de Droga/efeitos dos fármacos
Receptores de Droga/metabolismo
Receptores de Droga/ultraestrutura
Sensação/efeitos dos fármacos
Transdução de Sinais/genética
Canais de Cátion TRPV
Canais de Receptores Transientes de Potencial
Limites: Animais
Tipo de Publ: Research Support, U.S. Gov't, Non-P.H.S.
Research Support, U.S. Gov't, P.H.S.
Responsável: BR1.1 - BIREME


  3 / 314 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Machado, Rosangela Zacarias
Texto completo
Id: biblio-1042527
Autor: Ramos, Inalda Angélica de Souza; Herrera, Heitor Miraglia; Mendes, Natália Serra; Fernandes, Simone de Jesus; Campos, João Bosco Vilela; Alves, João Vitor Almeida; Macedo, Gabriel Carvalho de; Machado, Rosangela Zacarias; André, Marcos Rogério.
Título: Phylogeography of msp4 genotypes of Anaplasma marginale in beef cattle from the Brazilian Pantanal / Filogeografia de genótipos msp4 de Anaplasma marginale em gado de corte no Pantanal brasileiro
Fonte: Rev. bras. parasitol. vet;28(3):451-457, July-Sept. 2019. tab, graf.
Idioma: en.
Projeto: FAPESP; . FUNDECT; . CNPq; . CNPq; . CAPES.
Resumo: Abstract The msp4 gene of A. marginale is unicodon, stable and mostly homogeneous, being considered as a useful marker for phylogeographic characterization of this bacterium. The objective of this work was to analyze the phylogeography of A. marginale based on the msp4 gene in beef cattle from the Brazilian Pantanal, compared to those found in other regions worldwide. The blood samples investigated were collected from 400 animals (200 cows and 200 calves) reared in five extensive breeding farms in this region. The results indicated that of the evaluated samples, 56.75% (227/400) were positive for A. marginale based on the msp1β gene by quantitatitve PCR (qPCR), while 8.37% (19/227) were positive for the msp4 gene in the conventional PCR. In the Network distance analysis, 14 sequences from the Brazilian Pantanal were grouped into a single group with those from Thailand, India, Spain, Colombia, Parana (Brazil), Mexico, Portugal, Argentina, China, Venezuela, Australia, Italy and Minas Gerais (Brazil). Among 68 sequences from Brazil and the world, 15 genotypes were present while genotype number one (#1) was the most distributed worldwide. Both Splitstree and network analyses showed that the A. marginale msp4 sequences detected in beef cattle from the Brazilian Pantanal showed low polymorphism, with the formation of one genogroup phylogenetically related to those found in ruminants from South and Central America, Europe, and Asia.

Resumo O gene msp4 de A. marginale é unicodon, estável e pouco heterogêneo, sendo considerado como um marcador útil para caracterização filogeográfica desta bactéria. Este trabalho teve como objetivo analisar a filogeografia de A. marginale com base no gene msp4 em bovinos de corte do Pantanal Brasileiro, comparativamente a outra regiões do mundo. Alíquotas de sangue foram colhidas de 400 bovinos (200 vacas e 200 bezerros) em cinco propriedades de cria e recria extensiva. Como resultado, 56,75% (227/400) mostraram-se positivas para A. marginale pela qPCR para o gene msp1β e destas, 8,37% (19/227) amostras foram positivas na PCR convencional para o gene msp4. Na análise de distância Network, 14 sequências do Pantanal brasileiro foram agrupadas em um único grupo com as da Thailândia, Índia, Espanha, Colômbia, Paraná (Brasil), México, Portugal, Argentina, China, Venezuela, Austrália, Italia e Minas Gerais (Brasil). Dentre 68 sequências do Brasil e do mundo, constatou-se a presença de 15 genótipos, sendo o genótipo número um (#1) o mais distribuído. As sequências msp4 de A. marginale detectadas em bovinos de corte no Pantanal brasileiro apresentaram baixo polimorfismo com formação de dois genogrupos filogeneticamente relacionados àqueles encontrados em ruminantes de países das América do Sul e Central, Europa e Ásia.
Descritores: Proteínas de Bactérias/genética
Bovinos/microbiologia
Anaplasma marginale/genética
Filogeografia/métodos
Proteínas de Membrana/genética
-Ásia
América
Brasil
DNA Bacteriano/genética
Dados de Sequência Molecular
Reação em Cadeia da Polimerase
Sequência de Aminoácidos
Anaplasma marginale/isolamento & purificação
Europa (Continente)
Genótipo
Limites: Animais
Masculino
Feminino
Tipo de Publ: Estudo Comparativo
Responsável: BR1.1 - BIREME


  4 / 314 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Tendler, Miriam
Texto completo
Id: lil-295892
Autor: Ramos, Celso Raul Romero; Vilar, Mônica Magno; Nascimento, Ana Lúcia Tabet Oller; Ho, Paulo Lee; Thaumaturgo, Nilton; Edelenyi, Ricardo; Almeida, Marília; Dias, Waldely de Oliveira; Diogo, Catia Maria; Tendler, Miriam.
Título: r-Sm14 - pRSETA efficacy in experimental animals
Fonte: Mem. Inst. Oswaldo Cruz;96(suppl):131-135, Sept. 2001. ilus, tab.
Idioma: en.
Resumo: Previous studies carried out with Sm14 in experimental vaccination against Schistosoma mansoni or Fasciola hepatica infections were performed with recombinant Sm14 (rSm14) produced in Escherichia coli by the pGEMEX system (Promega). The rSm14 was expressed as a 40 kDa fusion protein with the major bacteriophage T7 capsid protein. Vaccination experiments with this rSm14 in animal models resulted in consistent high protective activity against S. mansoni cercariae challenge and enabled rSm14 to be included among the vaccine antigens endorsed by the World Health Organization for phase I/II clinical trials. Since the preparation of pGEMEX based rSm14 is time consuming and results in low yield for large scale production, we have tested other E. coli expression systems which would be more suitable for scale up and downstream processing. We expressed two different 6XHis-tagged Sm14 fusion proteins in a T7 promoter based plasmids. The 6XHis-tag fusions allowed rapid purification of the recombinant proteins through a Ni+2-charged resin. The resulted recombinant 18 and 16 kDa proteins were recognized by anti-Sm14 antibodies and also by antiserum against adult S. mansoni soluble secreted/excreted proteins in Western-Blot. Both proteins were also protective against S. mansoni cercariae infection to the same extent as the rSm14 expressed by the pGEMEX system
Descritores: Schistosoma mansoni/imunologia
Proteínas Recombinantes
Anticorpos Anti-Helmínticos/fisiologia
Proteínas de Helminto/fisiologia
-Plasmídeos
Proteínas Recombinantes/isolamento & purificação
Proteínas de Transporte
Proteínas de Helminto/isolamento & purificação
Western Blotting
Sequência de Aminoácidos
Vacinação
DNA Complementar
Modelos Animais
Eletroforese em Gel de Poliacrilamida
Escherichia coli
Ácidos Graxos
Limites: Animais
Feminino
Camundongos
Tipo de Publ: Research Support, Non-U.S. Gov't
Responsável: BR1.1 - BIREME


  5 / 314 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-1089293
Autor: Guzzi, A F; Oliveira, F S L; Amaro, M M S; Tavares-Filho, P F; Gabriel, J E.
Título: In silico prediction of the functional and structural consequences of the non-synonymous single nucleotide polymorphism A122V in bovine CXC chemokine receptor type 1 / Predição in silico das consequências funcionais e estruturais do polimorfismo de nucleotídeo único não-sinônimo A122V no receptor de quimiocina CXC do tipo I bovino
Fonte: Braz. j. biol;80(1):39-46, Feb. 2020. graf.
Idioma: en.
Resumo: Abstract The current study aimed to assess whether the A122V causal polymorphism promotes alterations in the functional and structural proprieties of the CXC chemokine receptor type 1 protein (CXCR1) of cattle Bos taurus by in silico analyses. Two amino acid sequences of bovine CXCR1 was selected from database UniProtKB/Swiss-Prot: a) non-polymorphic sequence (A7KWG0) with alanine (A) at position 122, and b) polymorphic sequence harboring the A122V polymorphism, substituting alanine by valine (V) at same position. CXCR1 sequences were submitted as input to different Bioinformatics' tools to examine the effects of this polymorphism on functional and structural stabilities, to predict eventual alterations in the 3-D structural modeling, and to estimate the quality and accuracy of the predictive models. The A122V polymorphism exerted tolerable and non-deleterious effects on the polymorphic CXCR1, and the predictive structural model for polymorphic CXCR1 revealed an alpha helix spatial structure typical of a receptor transmembrane polypeptide. Although higher variations in the distances between pairs of amino acid residues at target-positions are detected in the polymorphic CXCR1 protein, more than 97% of the amino acid residues in both models were located in favored and allowed conformational regions in Ramachandran plots. Evidences has supported that the A122V polymorphism in the CXCR1 protein is associated with increased clinical mastitis incidence in dairy cows. Thus, the findings described herein prove that the replacement of the alanine by valine amino acids provokes local conformational changes in the A122V-harboring CXCR1 protein, which could directly affect its post-translational folding mechanisms and biological functionality.

Resumo O presente estudo objetivou avaliar se o polimorfismo causal A122V promove alterações nas propriedades funcionais e estruturais da proteína receptora de quimiocina CXC do tipo 1 (CXCR1) de bovino Bos taurus por análises in silico. Duas sequências de aminoácidos da CXCR1 bovina foram selecionadas a partir do banco de dados UniProtKB/Swiss-Prot: a) sequência não-polimórfica (A7KWG0) contendo alanina (A) na posição 122, e b) sequência polimórfica carreando o polimorfismo A122V, causando a substituição de alanina por valina (V) na mesma posição. As sequências CXCR1 foram analisadas por diferentes ferramentas de Bioinformática para examinar o efeito desse polimorfismo sobre sua estabilidade, função e estrutura, predizer eventuais alterações na sua modelagem estrutural 3-D, bem como estimar a qualidade dos modelos preditos. O polimorfismo A122V exerceu efeitos toleráveis e não-deletérios sobre a CXCR1 polimórfica, apresentando um modelo estrutural de alfa-hélice típico de uma proteína receptora transmembranar para ambas as proteínas. Embora maiores variações nas distâncias entre os pares de aminoácidos nas posições-alvo tenham sido detectadas na proteína polimórfica, mais do que 97% dos aminoácidos em ambos os modelos foram situados em regiões ditas favoráveis e permitidas nos diagramas de Ramachandran. Evidências sustentam que o polimorfismo de nucleotídeo único A122V na proteína receptora CXCR1 está associado à aumentada incidência de mastite clínica em vacas leiteiras. Assim, as descobertas descritas aqui comprovam que a substituição do aminoácido alanina por valina provoca mudanças conformacionais locais na proteína CXCR1 polimórfica, que podem estar diretamente afetando seus mecanismos de enovelamento pós-traducionais e sua função biológica.
Descritores: Polimorfismo de Nucleotídeo Único
Receptores de Interleucina-8A
-Bovinos
Sequência de Aminoácidos
Limites: Animais
Feminino
Responsável: BR1.1 - BIREME


  6 / 314 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-780832
Autor: Yao, Lin; Tan, Chong; Song, Jinzhu; Yang, Qian; Yu, Lijie; Li, Xinling.
Título: Isolation and expression of two polyketide synthase genes from Trichoderma harzianum 88 during mycoparasitism
Fonte: Braz. j. microbiol;47(2):468-479, Apr.-June 2016. tab, graf.
Idioma: en.
Projeto: National Science Foundation for Distinguished Young Scholars of China.
Resumo: Abstract Metabolites of mycoparasitic fungal species such as Trichoderma harzianum 88 have important biological roles. In this study, two new ketoacyl synthase (KS) fragments were isolated from cultured Trichoderma harzianum 88 mycelia using degenerate primers and analysed using a phylogenetic tree. The gene fragments were determined to be present as single copies in Trichoderma harzianum 88 through southern blot analysis using digoxigenin-labelled KS gene fragments as probes. The complete sequence analysis in formation of pksT-1 (5669 bp) and pksT-2 (7901 bp) suggests that pksT-1 exhibited features of a non-reducing type I fungal PKS, whereas pksT-2 exhibited features of a highly reducing type I fungal PKS. Reverse transcription polymerase chain reaction indicated that the isolated genes are differentially regulated in Trichoderma harzianum 88 during challenge with three fungal plant pathogens, which suggests that they participate in the response of Trichoderma harzianum 88 to fungal plant pathogens. Furthermore, disruption of the pksT-2 encoding ketosynthase–acyltransferase domains through Agrobacterium -mediated gene transformation indicated that pksT-2 is a key factor for conidial pigmentation in Trichoderma harzianum 88.
Descritores: Trichoderma/enzimologia
Proteínas Fúngicas/metabolismo
Policetídeo Sintases/metabolismo
-Doenças das Plantas/microbiologia
Trichoderma/classificação
Trichoderma/genética
Proteínas Fúngicas/genética
Proteínas Fúngicas/química
Dados de Sequência Molecular
Regulação Fúngica da Expressão Gênica
Alinhamento de Sequência
Sequência de Aminoácidos
Micélio/enzimologia
Micélio/genética
Policetídeo Sintases/genética
Policetídeo Sintases/química
Responsável: BR1.1 - BIREME


  7 / 314 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Zanetti, Maria Lúcia
Texto completo
Id: lil-732953
Autor: Pereira, Dayse Christina Rodrigues; Araújo, Márcio Flávio Moura de; Freitas, Roberto Wagner Júnior Freire de; Teixeira, Carla Regina de Souza; Zanetti, Maria Lúcia; Damasceno, Marta Maria Coelho.
Título: Neck circumference as a potential marker of metabolic syndrome among college students / Circunferência do pescoço como possível marcador para síndrome metabólica em universitários / La circunferencia del cuello como posible indicador del síndrome metabólico en universitarios
Fonte: Rev. latinoam. enferm;22(6):973-979, 16/12/2014. tab.
Idioma: en.
Projeto: Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq).
Resumo: OBJECTIVE: to relate neck circumference with metabolic syndrome and its criteria among college students. METHOD: cross-sectional study conducted with 702 college students in Fortaleza, CE, Brazil from September 2010 to June 2011. Socio-demographic data, waist circumference and neck circumference were collected together with blood pressure, fasting blood sugar, triglyceride levels, and HDL-C. RESULTS: 1.7% of the studied sample presented metabolic syndrome. Of these, 58.3% presented altered neck circumference (p<0.006). As neck circumference decreases, pressure levels improve (p<0.001). Additionally, college students with high fasting blood sugar (p=0.003) and high triglyceride levels (p<0.001) presented higher values of neck circumference. CONCLUSION: neck circumference is a potential predictive marker in the detection of metabolic syndrome and its components among college students. .

OBJETIVO: relacionar a circunferência do pescoço com a síndrome metabólica e seus critérios em universitários. MÉTODO: estudo transversal, realizado com 702 universitários de Fortaleza, CE, Brasil, no período de setembro de 2010 a junho de 2011. Coletaram-se dados sociodemográficos, circunferência da cintura, circunferência do pescoço, níveis de pressão arterial e glicemia plasmática de jejum, triglicerídeos e lipoproteína de alta densidade. RESULTADOS: 1,7% da amostra investigada tinha a síndrome metabólica. Desses, 58,3% apresentaram circunferência do pescoço alterada (p<0,006). Na medida em que decresce a circunferência do pescoço, os valores pressóricos dos universitários melhoram (p<0,001). Também, observou-se que universitários com valores de glicemia de jejum plasmática (p=0,003) e triglicerídeos (p<0,001) elevados apresentaram maiores valores de circunferência do pescoço. CONCLUSÃO: a circunferência do pescoço mostrou-se um possível marcador preditivo para detecção da síndrome metabólica e seus componentes em universitários. .

OBJETIVO: relacionar la circunferencia del cuello con el síndrome metabólico y sus criterios en universitarios. MÉTODO: estudio transversal realizado con 702 universitarios de Fortaleza-CE, Brasil, en el período de septiembre de 2010 a junio de 2011. Se recolectaron datos sociodemográficos, circunferencia de la cintura, circunferencia del cuello, niveles de presión arterial y glucemia plasmática de ayuno, triglicéridos y HDL-C. RESULTADOS: 1,7% de la muestra investigada tenían el síndrome metabólico. De estos, 58,3% presentaron circunferencia del cuello alterada (p<0,006). A medida que decrece la circunferencia del cuello mejoran los valores de la presión de los universitarios (p<0,001). También, se observó que los universitarios con valores de glucemia de ayuno plasmática (p=0,003) y triglicéridos (p<0,001) elevados presentaron mayores valores de circunferencia del cuello. CONCLUSIÓN: la circunferencia del cuello se mostró un posible indicador de predicción para la detección del síndrome metabólico y sus componentes, en universitarios. .
Descritores: Catepsinas/fisiologia
Lisossomos/metabolismo
Proteínas/metabolismo
-Sequência de Aminoácidos
Autofagia
Sequência de Bases
Catepsinas/antagonistas & inibidores
Catepsinas/genética
Compartimento Celular
Cicloeximida/farmacologia
Cistatinas/fisiologia
Regulação da Expressão Gênica
Leucina/análogos & derivados
Leucina/farmacologia
Lisossomos/enzimologia
Dados de Sequência Molecular
Doenças Musculares/fisiopatologia
Mapeamento por Restrição
Limites: Humanos
Animais
Tipo de Publ: Revisão
Responsável: BR1.1 - BIREME


  8 / 314 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Carvalho, Emília Campos de
Texto completo
Id: lil-752510
Autor: Teixeira, Carla Regina de Souza; Pereira, Marta Cristiane Alves; Kusumota, Luciana; Gaioso, Vanessa Pirani; Mello, Carolina Lima de; Carvalho, Emília Campos de.
Título: Avaliação dos estudantes de enfermagem sobre a aprendizagem com a simulação clínica / Evaluación de los estudiantes de enfermería sobre el aprendizaje con la simulación clínica / Evaluation of nursing students about learning with clinical simulation
Fonte: Rev. bras. enferm;68(2):311-319, Mar-Apr/2015. tab.
Idioma: pt.
Projeto: Conselho Nacional de Desenvolvimento Científico e Tecnológico.
Resumo: RESUMO Objetivo: descrever as contribuições da simulação clínica para aprendizagem de atributos cognitivos e procedimentais, por meio do debriefing, na perspectiva dos estudantes de enfermagem. Método: estudo descritivo exploratório. Participaram 20 estudantes de Graduação em Enfermagem de uma universidade do interior paulista. Na coleta de dados, realizada na etapa do debriefing, foi registrada a percepção do aluno sobre a simulação, aspectos positivos e o que poderia ser feito de forma diferente. Os relatos foram agrupados em categorias temáticas centrais, segundo referencial de análise de conteúdo de Bardin (2011), analisadas por meio de estatística descritiva. Resultados: identificada valorização da aprendizagem ativa, crítica e reflexiva (47,5%) em decorrência da aproximação à realidade assistencial (20,3%), manifestação dos sentimentos vivenciados durante a simulação (16,9%) e composição do cenário (15,3%). Conclusão: a simulação clínica seguida do debriefing favorece a compreensão da relação entre ação e resultados alcançados na aprendizagem. .

RESUMEN Objetivo: describir las contribuciones de simulación clínica para aprender atributos cognitivos y de procedimiento, a través de debriefing, desde la perspectiva de los estudiantes de enfermería. Método: estudio exploratorio descriptivo. 20 estudiantes participaron en el Pregrado en Enfermería de una universidad de São Paulo. Durante la recolección de datos, que se aplicó durante el debriefing, fue grabado en la percepción de los estudiantes de la simulación, los aspectos positivos y lo que podría hacerse de otra manera. Los informes de los estudiantes se agrupan de acuerdo a los temas centrales, según el referencial de análisis de contenido de Bardin (2011) y analizados mediante estadística descriptiva. Resultados: identificado la mejora de aprendizaje activo, crítico y reflexivo (47,5%) debido a la aproximación a la realidad en la atención de enfermería (20,3%), un resultado de la composición del escenario (16,9%), lo que favorece el desarrollo de sentimientos experimentados durante la simulación (15,3%). Conclusión: la simulación clínica seguida de debriefing favorece la comprensión de la relación entre la acción y los resultados obtenidos en el aprendizaje. .

ABSTRACT Objective: to describe the contributions of clinical simulation for learning cognitive and procedural attributes through debriefi ng, from the perspective of nursing students. Method: descriptive exploratory study. Twenty nursing undergraduate students from a university in the interior of the state of São Paulo participated in this study. Data collection was performed at the debriefi ng stage. Student’s perceptions about the simulation, positive aspects and what they could have done differently were registered. The students’ statements were grouped according to the central themes and the framework of Bardin’s content analysis (2011) and were analyzed using descriptive statistics. Results: enhancement of active, critical and refl ective learning (47.5%) was identifi ed due to the closeness to reality in nursing care (20.3%), manifestation of feelings experienced during the simulation (15.3%) and composition of the scenario (15.3%). Conclusion: the clinical simulation followed by debriefi ng promotes the understanding of the link between action and achievements in learning. .
Descritores: Proteínas de Arabidopsis/metabolismo
Arabidopsis/crescimento & desenvolvimento
Arabidopsis/imunologia
Imunidade Inata/imunologia
Fragmentos de Peptídeos/imunologia
Imunidade Vegetal/imunologia
Receptores de Reconhecimento de Padrão/imunologia
-Sequência de Aminoácidos
Arabidopsis/genética
Western Blotting
Regulação da Expressão Gênica de Plantas
Dados de Sequência Molecular
Raízes de Plantas/crescimento & desenvolvimento
Raízes de Plantas/imunologia
Raízes de Plantas/metabolismo
RNA Mensageiro/genética
Reação em Cadeia da Polimerase em Tempo Real
Receptores de Reconhecimento de Padrão/metabolismo
Reação em Cadeia da Polimerase Via Transcriptase Reversa
Homologia de Sequência de Aminoácidos
Transdução de Sinais
Tipo de Publ: Research Support, Non-U.S. Gov't
Responsável: BR1.1 - BIREME


  9 / 314 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-623964
Autor: Zhu, Xing-Zu.
Título: Development of natural products as drugs acting on central nervous system
Fonte: Mem. Inst. Oswaldo Cruz;86(supl.2):173-175, 1991.
Idioma: en.
Conferência: Apresentado em: Brazilian-Sino Symposium on Chemistry and Pharmacology of Natural Products, Rio de Janeiro, Dec. 10-14, 1989.
Resumo: We have recenty studied several natural product constituents which have effects on the CNS. (1) Tetrahydropalmatine (THP) and its analogues were isolated from Corydalis ambigua and various species of Stephania. (+)-THP and (-)-THP posses not only analgesic activity, but also exert sedative-tranquillizing and hypnotic actions. Results of receptor binding assay and their pre-and post-synaptic effects on dopaminergic system indicate that (-)-THP and (-)-stepholidine are dopamine receptor antagonists while (+)-THP is a selective dopamine depletor. (2) 3-Acetylaconitine (AAC) is an alkaloid isolated from Aconitum flavum. The relative potency of analgesic action of AAC was 5.1-35.6 and 1250-3912 times that of morphine and aspirin, respectively. The analgesic effect of AAC was antagonized by naloxone, but was eliminated by reserpine. In monkeys, after AAC was injected for 92 days, no abstinence syndrome was seen after sudden AAC withdrawal or when challenged with nalorphine. (3) Huperzine A (Hup-A) is an alkaloid isolated from Huperzia serrata which was found to be a selective ChE inhibitor and could improve learning and retrieval process. Preliminary clinical studies showed that Hup-A improve short-and long-term memory in patients of cerebral arteriosclerosis with memory impairment. (4) Ranamargarin is a new tetradecapeptide isolated from the skin of the Chines frog Rana margaratae. This peptide may mainly act on NK-1 receptor.
Descritores: Medicamentos de Ervas Chinesas/farmacologia
Depressores do Sistema Nervoso Central/farmacologia
Fármacos do Sistema Nervoso Central/farmacologia
Transtornos da Memória/tratamento farmacológico
-Dados de Sequência Molecular
Sequência de Aminoácidos
Avaliação de Medicamentos
Avaliação Pré-Clínica de Medicamentos
Limites: Humanos
Animais
Responsável: BR1.1 - BIREME


  10 / 314 LILACS  
              first record previous record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-773437
Autor: Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang.
Título: Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis
Fonte: J. venom. anim. toxins incl. trop. dis;22:5, 2016. tab, graf, ilus.
Idioma: en.
Projeto: Chinese National Natural Science Foundation; . Research Foundation of Kunming University; . Research Foundation of Kunming University.
Resumo: Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)
Descritores: Peptídeos/isolamento & purificação
Análise de Sequência de DNA/métodos
Baratas/imunologia
Peptídeos Catiônicos Antimicrobianos/química
-Sequência de Aminoácidos
Anti-Infecciosos/análise
Limites: Animais
Responsável: BR1.1 - BIREME



página 1 de 32 ir para página                         
   


Refinar a pesquisa
  Base de dados : Formulário avançado   

    Pesquisar no campo  
1  
2
3
 
           



Search engine: iAH v2.6 powered by WWWISIS

BIREME/OPAS/OMS - Centro Latino-Americano e do Caribe de Informação em Ciências da Saúde