Base de dados : LILACS
Pesquisa : G02.111.570.060 [Categoria DeCS]
Referências encontradas : 312 [refinar]
Mostrando: 1 .. 10   no formato [Detalhado]

página 1 de 32 ir para página                         

  1 / 312 LILACS  
              next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-780832
Autor: Yao, Lin; Tan, Chong; Song, Jinzhu; Yang, Qian; Yu, Lijie; Li, Xinling.
Título: Isolation and expression of two polyketide synthase genes from Trichoderma harzianum 88 during mycoparasitism
Fonte: Braz. j. microbiol;47(2):468-479, Apr.-June 2016. tab, graf.
Idioma: en.
Projeto: National Science Foundation for Distinguished Young Scholars of China.
Resumo: Abstract Metabolites of mycoparasitic fungal species such as Trichoderma harzianum 88 have important biological roles. In this study, two new ketoacyl synthase (KS) fragments were isolated from cultured Trichoderma harzianum 88 mycelia using degenerate primers and analysed using a phylogenetic tree. The gene fragments were determined to be present as single copies in Trichoderma harzianum 88 through southern blot analysis using digoxigenin-labelled KS gene fragments as probes. The complete sequence analysis in formation of pksT-1 (5669 bp) and pksT-2 (7901 bp) suggests that pksT-1 exhibited features of a non-reducing type I fungal PKS, whereas pksT-2 exhibited features of a highly reducing type I fungal PKS. Reverse transcription polymerase chain reaction indicated that the isolated genes are differentially regulated in Trichoderma harzianum 88 during challenge with three fungal plant pathogens, which suggests that they participate in the response of Trichoderma harzianum 88 to fungal plant pathogens. Furthermore, disruption of the pksT-2 encoding ketosynthase–acyltransferase domains through Agrobacterium -mediated gene transformation indicated that pksT-2 is a key factor for conidial pigmentation in Trichoderma harzianum 88.
Descritores: Trichoderma/enzimologia
Proteínas Fúngicas/metabolismo
Policetídeo Sintases/metabolismo
-Doenças das Plantas/microbiologia
Trichoderma/classificação
Trichoderma/genética
Proteínas Fúngicas/genética
Proteínas Fúngicas/química
Dados de Sequência Molecular
Regulação Fúngica da Expressão Gênica
Alinhamento de Sequência
Sequência de Aminoácidos
Micélio/enzimologia
Micélio/genética
Policetídeo Sintases/genética
Policetídeo Sintases/química
Responsável: BR1.1 - BIREME


  2 / 312 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Zanetti, Maria Lúcia
Texto completo
Id: lil-732953
Autor: Pereira, Dayse Christina Rodrigues; Araújo, Márcio Flávio Moura de; Freitas, Roberto Wagner Júnior Freire de; Teixeira, Carla Regina de Souza; Zanetti, Maria Lúcia; Damasceno, Marta Maria Coelho.
Título: Neck circumference as a potential marker of metabolic syndrome among college students / Circunferência do pescoço como possível marcador para síndrome metabólica em universitários / La circunferencia del cuello como posible indicador del síndrome metabólico en universitarios
Fonte: Rev. latinoam. enferm;22(6):973-979, 16/12/2014. tab.
Idioma: en.
Projeto: Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq).
Resumo: OBJECTIVE: to relate neck circumference with metabolic syndrome and its criteria among college students. METHOD: cross-sectional study conducted with 702 college students in Fortaleza, CE, Brazil from September 2010 to June 2011. Socio-demographic data, waist circumference and neck circumference were collected together with blood pressure, fasting blood sugar, triglyceride levels, and HDL-C. RESULTS: 1.7% of the studied sample presented metabolic syndrome. Of these, 58.3% presented altered neck circumference (p<0.006). As neck circumference decreases, pressure levels improve (p<0.001). Additionally, college students with high fasting blood sugar (p=0.003) and high triglyceride levels (p<0.001) presented higher values of neck circumference. CONCLUSION: neck circumference is a potential predictive marker in the detection of metabolic syndrome and its components among college students. .

OBJETIVO: relacionar a circunferência do pescoço com a síndrome metabólica e seus critérios em universitários. MÉTODO: estudo transversal, realizado com 702 universitários de Fortaleza, CE, Brasil, no período de setembro de 2010 a junho de 2011. Coletaram-se dados sociodemográficos, circunferência da cintura, circunferência do pescoço, níveis de pressão arterial e glicemia plasmática de jejum, triglicerídeos e lipoproteína de alta densidade. RESULTADOS: 1,7% da amostra investigada tinha a síndrome metabólica. Desses, 58,3% apresentaram circunferência do pescoço alterada (p<0,006). Na medida em que decresce a circunferência do pescoço, os valores pressóricos dos universitários melhoram (p<0,001). Também, observou-se que universitários com valores de glicemia de jejum plasmática (p=0,003) e triglicerídeos (p<0,001) elevados apresentaram maiores valores de circunferência do pescoço. CONCLUSÃO: a circunferência do pescoço mostrou-se um possível marcador preditivo para detecção da síndrome metabólica e seus componentes em universitários. .

OBJETIVO: relacionar la circunferencia del cuello con el síndrome metabólico y sus criterios en universitarios. MÉTODO: estudio transversal realizado con 702 universitarios de Fortaleza-CE, Brasil, en el período de septiembre de 2010 a junio de 2011. Se recolectaron datos sociodemográficos, circunferencia de la cintura, circunferencia del cuello, niveles de presión arterial y glucemia plasmática de ayuno, triglicéridos y HDL-C. RESULTADOS: 1,7% de la muestra investigada tenían el síndrome metabólico. De estos, 58,3% presentaron circunferencia del cuello alterada (p<0,006). A medida que decrece la circunferencia del cuello mejoran los valores de la presión de los universitarios (p<0,001). También, se observó que los universitarios con valores de glucemia de ayuno plasmática (p=0,003) y triglicéridos (p<0,001) elevados presentaron mayores valores de circunferencia del cuello. CONCLUSIÓN: la circunferencia del cuello se mostró un posible indicador de predicción para la detección del síndrome metabólico y sus componentes, en universitarios. .
Descritores: Catepsinas/fisiologia
Lisossomos/metabolismo
Proteínas/metabolismo
-Sequência de Aminoácidos
Autofagia
Sequência de Bases
Catepsinas/antagonistas & inibidores
Catepsinas/genética
Compartimento Celular
Cicloeximida/farmacologia
Cistatinas/fisiologia
Regulação da Expressão Gênica
Leucina/análogos & derivados
Leucina/farmacologia
Lisossomos/enzimologia
Dados de Sequência Molecular
Doenças Musculares/fisiopatologia
Mapeamento por Restrição
Limites: Seres Humanos
Animais
Tipo de Publ: Revisão
Responsável: BR1.1 - BIREME


  3 / 312 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Carvalho, Emília Campos de
Texto completo
Id: lil-752510
Autor: Teixeira, Carla Regina de Souza; Pereira, Marta Cristiane Alves; Kusumota, Luciana; Gaioso, Vanessa Pirani; Mello, Carolina Lima de; Carvalho, Emília Campos de.
Título: Avaliação dos estudantes de enfermagem sobre a aprendizagem com a simulação clínica / Evaluación de los estudiantes de enfermería sobre el aprendizaje con la simulación clínica / Evaluation of nursing students about learning with clinical simulation
Fonte: Rev. bras. enferm;68(2):311-319, Mar-Apr/2015. tab.
Idioma: pt.
Projeto: Conselho Nacional de Desenvolvimento Científico e Tecnológico.
Resumo: RESUMO Objetivo: descrever as contribuições da simulação clínica para aprendizagem de atributos cognitivos e procedimentais, por meio do debriefing, na perspectiva dos estudantes de enfermagem. Método: estudo descritivo exploratório. Participaram 20 estudantes de Graduação em Enfermagem de uma universidade do interior paulista. Na coleta de dados, realizada na etapa do debriefing, foi registrada a percepção do aluno sobre a simulação, aspectos positivos e o que poderia ser feito de forma diferente. Os relatos foram agrupados em categorias temáticas centrais, segundo referencial de análise de conteúdo de Bardin (2011), analisadas por meio de estatística descritiva. Resultados: identificada valorização da aprendizagem ativa, crítica e reflexiva (47,5%) em decorrência da aproximação à realidade assistencial (20,3%), manifestação dos sentimentos vivenciados durante a simulação (16,9%) e composição do cenário (15,3%). Conclusão: a simulação clínica seguida do debriefing favorece a compreensão da relação entre ação e resultados alcançados na aprendizagem. .

RESUMEN Objetivo: describir las contribuciones de simulación clínica para aprender atributos cognitivos y de procedimiento, a través de debriefing, desde la perspectiva de los estudiantes de enfermería. Método: estudio exploratorio descriptivo. 20 estudiantes participaron en el Pregrado en Enfermería de una universidad de São Paulo. Durante la recolección de datos, que se aplicó durante el debriefing, fue grabado en la percepción de los estudiantes de la simulación, los aspectos positivos y lo que podría hacerse de otra manera. Los informes de los estudiantes se agrupan de acuerdo a los temas centrales, según el referencial de análisis de contenido de Bardin (2011) y analizados mediante estadística descriptiva. Resultados: identificado la mejora de aprendizaje activo, crítico y reflexivo (47,5%) debido a la aproximación a la realidad en la atención de enfermería (20,3%), un resultado de la composición del escenario (16,9%), lo que favorece el desarrollo de sentimientos experimentados durante la simulación (15,3%). Conclusión: la simulación clínica seguida de debriefing favorece la comprensión de la relación entre la acción y los resultados obtenidos en el aprendizaje. .

ABSTRACT Objective: to describe the contributions of clinical simulation for learning cognitive and procedural attributes through debriefi ng, from the perspective of nursing students. Method: descriptive exploratory study. Twenty nursing undergraduate students from a university in the interior of the state of São Paulo participated in this study. Data collection was performed at the debriefi ng stage. Student’s perceptions about the simulation, positive aspects and what they could have done differently were registered. The students’ statements were grouped according to the central themes and the framework of Bardin’s content analysis (2011) and were analyzed using descriptive statistics. Results: enhancement of active, critical and refl ective learning (47.5%) was identifi ed due to the closeness to reality in nursing care (20.3%), manifestation of feelings experienced during the simulation (15.3%) and composition of the scenario (15.3%). Conclusion: the clinical simulation followed by debriefi ng promotes the understanding of the link between action and achievements in learning. .
Descritores: Proteínas de Arabidopsis/metabolismo
Arabidopsis/crescimento & desenvolvimento
Arabidopsis/imunologia
Imunidade Inata/imunologia
Fragmentos de Peptídeos/imunologia
Imunidade Vegetal/imunologia
Receptores de Reconhecimento de Padrão/imunologia
-Sequência de Aminoácidos
Arabidopsis/genética
Western Blotting
Regulação da Expressão Gênica de Plantas
Dados de Sequência Molecular
Raízes de Plantas/crescimento & desenvolvimento
Raízes de Plantas/imunologia
Raízes de Plantas/metabolismo
RNA Mensageiro/genética
Reação em Cadeia da Polimerase em Tempo Real
Receptores de Reconhecimento de Padrão/metabolismo
Reação em Cadeia da Polimerase Via Transcriptase Reversa
Homologia de Sequência de Aminoácidos
Transdução de Sinais
Tipo de Publ: Research Support, Non-U.S. Gov't
Responsável: BR1.1 - BIREME


  4 / 312 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-623964
Autor: Zhu, Xing-Zu.
Título: Development of natural products as drugs acting on central nervous system
Fonte: Mem. Inst. Oswaldo Cruz;86(supl.2):173-175, 1991.
Idioma: en.
Conferência: Apresentado em: Brazilian-Sino Symposium on Chemistry and Pharmacology of Natural Products, Rio de Janeiro, Dec. 10-14, 1989.
Resumo: We have recenty studied several natural product constituents which have effects on the CNS. (1) Tetrahydropalmatine (THP) and its analogues were isolated from Corydalis ambigua and various species of Stephania. (+)-THP and (-)-THP posses not only analgesic activity, but also exert sedative-tranquillizing and hypnotic actions. Results of receptor binding assay and their pre-and post-synaptic effects on dopaminergic system indicate that (-)-THP and (-)-stepholidine are dopamine receptor antagonists while (+)-THP is a selective dopamine depletor. (2) 3-Acetylaconitine (AAC) is an alkaloid isolated from Aconitum flavum. The relative potency of analgesic action of AAC was 5.1-35.6 and 1250-3912 times that of morphine and aspirin, respectively. The analgesic effect of AAC was antagonized by naloxone, but was eliminated by reserpine. In monkeys, after AAC was injected for 92 days, no abstinence syndrome was seen after sudden AAC withdrawal or when challenged with nalorphine. (3) Huperzine A (Hup-A) is an alkaloid isolated from Huperzia serrata which was found to be a selective ChE inhibitor and could improve learning and retrieval process. Preliminary clinical studies showed that Hup-A improve short-and long-term memory in patients of cerebral arteriosclerosis with memory impairment. (4) Ranamargarin is a new tetradecapeptide isolated from the skin of the Chines frog Rana margaratae. This peptide may mainly act on NK-1 receptor.
Descritores: Medicamentos de Ervas Chinesas/farmacologia
Depressores do Sistema Nervoso Central/farmacologia
Fármacos do Sistema Nervoso Central/farmacologia
Transtornos da Memória/tratamento farmacológico
-Dados de Sequência Molecular
Sequência de Aminoácidos
Avaliação de Medicamentos
Avaliação Pré-Clínica de Medicamentos
Limites: Seres Humanos
Animais
Responsável: BR1.1 - BIREME


  5 / 312 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: lil-773437
Autor: Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang.
Título: Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis
Fonte: J. venom. anim. toxins incl. trop. dis;22:5, 2016. tab, graf, ilus.
Idioma: en.
Projeto: Chinese National Natural Science Foundation; . Research Foundation of Kunming University; . Research Foundation of Kunming University.
Resumo: Abstract Background Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. Methods The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. Results A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). Conclusions This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects.(AU)
Descritores: Peptídeos/isolamento & purificação
Análise de Sequência de DNA/métodos
Baratas/imunologia
Peptídeos Catiônicos Antimicrobianos/química
-Sequência de Aminoácidos
Anti-Infecciosos/análise
Limites: Animais
Responsável: BR1.1 - BIREME


  6 / 312 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
Id: biblio-1010283
Autor: Niu, Dandan; Tian, Xiaojing; Peace Mchunu, Nokuthula; Jia, Chao; Singh, Suren; Liu, Xiaoguang; Prior, Bernard A; Lu, Fuping.
Título: Biochemical characterization of three Aspergillus niger ß-galactosidases
Fonte: Electron. j. biotechnol;27:37-43, May. 2017. tab, ilus, graf.
Idioma: en.
Projeto: National Natural Science Foundation of China; . National Natural Science Foundation of Fujian Province, China; . Priming Scientific Research Foundation of Fuzhou University.
Resumo: Background: ß-Galactosidases catalyze both hydrolytic and transgalactosylation reactions and therefore have many applications in food, medical, and biotechnological fields. Aspergillus niger has been a main source of ß-galactosidase, but the properties of this enzyme are incompletely studied. Results: Three new ß-galactosidases belonging to glycosyl hydrolase family 35 from A. niger F0215 were cloned, expressed, and biochemically characterized. In addition to the known activity of LacA encoded by lacA, three putative ß-galactosidases, designated as LacB, LacC, and LacE encoded by the genes lacB, lacC, and lacE, respectively, were successfully cloned, sequenced, and expressed and secreted by Pichia pastoris. These three proteins and LacA have N-terminal signal sequences and are therefore predicted to be extracellular enzymes. They have the typical structure of fungal ß-galactosidases with defined hydrolytic and transgalactosylation activities on lactose. However, their activity properties differed. In particular, LacB and lacE displayed maximum hydrolytic activity at pH 4­5 and 50°C, while LacC exhibited maximum activity at pH 3.5 and 60°C. All ß-galactosidases performed transgalactosylation activity optimally in an acidic environment. Conclusions: Three new ß-galactosidases belonging to glycosyl hydrolase family 35 from A. niger F0215 were cloned and biochemically characterized. In addition to the known LacA, A. niger has at least three ß-galactosidase family members with remarkably different biochemical properties.
Descritores: Aspergillus niger/enzimologia
beta-Galactosidase/química
-Especificidade por Substrato
Cinética
Sequência de Aminoácidos
Clonagem Molecular
beta-Galactosidase/genética
beta-Galactosidase/metabolismo
Responsável: CL1.1 - Biblioteca Central


  7 / 312 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-954858
Autor: Valdez-Velázquez, Laura L; Olamendi-Portugal, Timoteo; Restano-Cassulini, Rita; Zamudio, Fernando Z; Possani, Lourival D.
Título: Mass fingerprinting and electrophysiological analysis of the venom from the scorpion Centruroides hirsutipalpus (Scorpiones: Buthidae)
Fonte: J. venom. anim. toxins incl. trop. dis;24:17, 2018. tab, graf, ilus.
Idioma: en.
Projeto: SEP-CONACyT; . SEP-CONACyT.
Resumo: Centruroides hirsutipalpus, of the family Buthidae, is a scorpion endemic to the Western Pacific region of Mexico. Although medically important, its venom has not yet been studied. Therefore, this communication aims to identify their venom components and possible functions. Methods Fingerprinting mass analysis of the soluble venom from this scorpion was achieved by high-performance liquid chromatography and electrospray mass spectrometry. Furthermore, the soluble venom and its toxic effects were evaluated extensively via electrophysiological assays in HEK cells expressing human voltage-gated Na+ channels (hNav 1.1 to Nav1.6), CHO cells expressing hNav 1.7, potassium channel hERG 1 (Ether-à-go-go-related-gene) and the human K+-channel hKv1.1. Results The separation of soluble venom produced 60 fractions from which 83 distinct components were identified. The molecular mass distribution of these components varies from 340 to 21,120 Da. Most of the peptides have a molecular weight between 7001 and 8000 Da (46% components), a range that usually corresponds to peptides known to affect Na+ channels. Peptides with molecular masses from 3000 to 5000 Da (28% of the components) were identified within the range corresponding to K+-channel blocking toxins. Two peptides were obtained in pure format and completely sequenced: one with 29 amino acids, showing sequence similarity to an "orphan peptide" of C. limpidus, and the other with 65 amino acid residues shown to be an arthropod toxin (lethal to crustaceans and toxic to crickets). The electrophysiological results of the whole soluble venom show a beta type modification of the currents of channels Nav1.1, Nav1.2 and Nav1.6. The main effect observed in channels hERG and hKv 1.1 was a reduction of the currents. Conclusion The venom contains more than 83 distinct components, among which are peptides that affect the function of human Na+-channels and K+-channels. Two new complete amino acid sequences were determined: one an arthropod toxin, the other a peptide of unknown function.(AU)
Descritores: Venenos de Escorpião/isolamento & purificação
Venenos de Escorpião/toxicidade
Eletrofisiologia/métodos
-Espectrometria de Massas/métodos
Sequência de Aminoácidos
Proteínas de Artrópodes/fisiologia
Limites: Animais
Responsável: BR33.1 - Divisão Técnica de Biblioteca e Documentação


  8 / 312 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Texto completo
Id: biblio-954851
Autor: Costa, Fábio L. S; Lima, Maria Elena De; Figueiredo, Suely G; Ferreira, Rafaela S; Prates, Núbia S; Sakamoto, Tetsu; Salas, Carlos E.
Título: Sequence analysis of the cDNA encoding for SpCTx: a lethal factor from scorpionfish venom ( Scorpaena plumieri )
Fonte: J. venom. anim. toxins incl. trop. dis;24:24, 2018. tab, ilus.
Idioma: en.
Projeto: CAPES; . CNPq/CAPES.
Resumo: Lethal factors are multifunctional oligomeric proteins found in the venomous apparatus of Scorpaeniformes fish. These toxins elicit not only an array of biological responses in vitro but also cardiovascular disorders and strong hemolytic, nociceptive and edematogenic activities in vivo. This work describes the cloning and molecular identification of two toxin subunits, denominated Sp-CTx-α and Sp-CTx-ß, from scorpionfish venom ( Scorpaena plumieri ). Methods: The primary structures were deduced after cDNA amplification by PCR with primers from conserved sequences described in Scorpaeniformes toxins. Following DNA sequencing and bioinformatic analysis, the tridimensional structures of both subunits were modeled. Results: The translated sequences (702 amino acids, each subunit) show homology with other lethal factors, while alignment between Sp-CTx-α and Sp-CTx-ß shows 54% identity. The subunits lack N-terminal signal sequences and display masses of approximately 80 kDa each. Both Sp-CTx subunits display a B30.2/SPRY domain at the C-terminal region with typically conserved motifs as described in these toxins. Secondary structure prediction identified six α-helices 18 residues long in both α and ß subunits, some of them amphiphilic with their N-terminal flanked by many basic residues, creating a cationic site associated with the cytolytic activity of these toxins. Antimicrobial potential sites were identified in Sp-CTx and share some features with other peptides presenting variable and broad-spectrum activity. A phylogenetic tree built to represent these toxins supports the proximity between scorpionfish, lionfish and stonefish. Conclusion: The study identified a putative toxin protein whose primary structure is similar to other fish toxins and with potential for production of antivenom against scorpionfish envenomation in Brazil. As a prelude to structure-function studies, we propose that the toxin is structurally related to pore-forming marine toxins.(AU)
Descritores: DNA Complementar/análise
Venenos de Peixe/toxicidade
-Peptídeos/análise
Antivenenos/classificação
Reação em Cadeia da Polimerase/métodos
Sequência de Aminoácidos
Limites: Animais
Responsável: BR33.1 - Divisão Técnica de Biblioteca e Documentação


  9 / 312 LILACS  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo SciELO Brasil
Mendonça, Berenice B
Texto completo
Id: biblio-840026
Autor: Sousa, Braian Lucas A; Nishi, Mirian Yumie; Santos, Mariza Gerdulo; Brito, Vinicius Nahime; Domenice, Sorahia; Mendonca, Berenice B.
Título: Mutation analysis of NANOS3 in Brazilian women with primary ovarian failure
Fonte: Clinics;71(12):695-698, Dec. 2016. tab, graf.
Idioma: en.
Projeto: CNPq; . CNPq; . FAPESP.
Resumo: OBJECTIVES: Primary ovarian failure is a rare disorder, and approximately 90% of cases are of unknown etiology. The aim of this study was to search for mutations in NANOS3, a gene that was recently related to the etiology of primary ovarian failure, in a group of Brazilian women. METHODS: We screened for NANOS3 DNA variants in 30 consecutive women who were previously diagnosed with primary ovarian failure, of unknown etiology and compared the results with those from 185 women with normal fertility. The NANOS3 gene was amplified by polymerase chain reaction using pairs of specific primers and then sequenced. The resulting sequences were compared with control sequences available in the National Center for Biotechnology and Information database. RESULTS: No mutations in NANOS3 were found in primary ovarian failure patients, but four previously described polymorphisms were identified at a similar frequency in the control and primary ovarian failure groups. CONCLUSIONS: Mutations in NANOS3 were not associated with primary ovarian failure in the present cohort.
Descritores: Proteínas de Ligação a RNA/genética
Insuficiência Ovariana Primária/genética
Mutação
-Polimorfismo Genético
Brasil
Análise Mutacional de DNA
Estudos de Casos e Controles
Reação em Cadeia da Polimerase
Estudos de Coortes
Sequência de Aminoácidos
Eletroforese/métodos
Alelos
Limites: Seres Humanos
Feminino
Adolescente
Adulto
Meia-Idade
Idoso
Adulto Jovem
Responsável: BR1.1 - BIREME


  10 / 312 LILACS  
              first record previous record
seleciona
para imprimir
Fotocópia
Texto completo
Id: biblio-1022119
Autor: Luchs, A; Timenetsky, M do C S T.
Título: Phylogenetic analysis of human group C rotavirus circulating in Brazil reveals a potential unique NSP4 genetic variant and high similarity with Asian strains
Fonte: Mol Genet Genomics;290(3):969-986, 2015.
Idioma: en.
Resumo: Group C rotaviruses (RVC) cause gastroenteritis in humans and animals worldwide, and the evidence for a possible zoonotic role has been recently provided. To gain information on the genetic diversity and relationships between human and animal RVC, we sequenced the VP4, VP7, and NSP4 genes of 12, 19, and 15 human strains, respectively, detected in São Paulo state during historical (1988 and 1993) and recent (2007 and 2008) Brazilian rotavirus surveillance. All RVC strains analyzed in the present study grouped into human genotype (G4-P[2]-E2), and did not show any evidence of animal ancestry. Phylogenetic analysis showed that RVC samples detected in 1988 and 1993 clustered together with strains from distinct continents, indicating that historical RVC strains circulating in São Paulo were closely related to those strains circulating worldwide. All three genes (VP7, VP4 and NSP4) of São Paulo RVC strains isolated in 2007-2008 exhibited close phylogenetic relationship with human RVC strains isolated in China and Japan, suggesting that they are genetically linked, and that a gene flow could be occurring between this Asian countries and Brazil. We identified two distinct clusters in the NSP4 phylogenetic tree. One cluster formed exclusively by human Brazilian strains detected in 1997 and 2003-2004 in Rio de Janeiro, Bahia, and Rio Grande do Sul states (Subgroup II) previously described in a different study, that displayed low sequence identities to other human strains formerly published, and to the Brazilian RVC strains (Subgroup I) characterized in the present study. These data suggests the circulation of two genetic profiles of the NSP4 gene in Brazil. High sequence diversity in NSP4 gene was previously reported in Asia, and additional diversity in NSP4 RVC strains spreading in the world should be expected. More in-depth molecular and epidemiological analysis of human RVC throughout the world will be needed to understand their diversity and clarify their evolution, as well as to develop classifications schemes.
Descritores:
Filogenia
Infecções por Rotavirus/virologia
Toxinas Biológicas/genética
Variação Genética
Brasil/epidemiologia
Seres Humanos
RNA
RNA Viral/isolamento & purificação
Dados de Sequência Molecular
Sequência de Bases
Glicoproteínas
Glicoproteínas/genética
Glicoproteínas/química
Criança
Pré-Escolar
Demografia
Alinhamento de Sequência
Adolescente
Sequência de Aminoácidos
Proteínas não Estruturais Virais
Proteínas não Estruturais Virais/genética
Homologia de Sequência de Aminoácidos
Análise de Sequência de DNA
Rotavirus
Adulto
Proteínas do Capsídeo/química
Gastroenterite/virologia
Genótipo
Lactente
Animais
Meia-Idade
Antígenos Virais/genética
Responsável: BR91.2 - Centro de Documentação



página 1 de 32 ir para página                         
   


Refinar a pesquisa
  Base de dados : Formulário avançado   

    Pesquisar no campo  
1  
2
3
 
           



Search engine: iAH v2.6 powered by WWWISIS

BIREME/OPAS/OMS - Centro Latino-Americano e do Caribe de Informação em Ciências da Saúde