Base de dados : MEDLINE
Pesquisa : B01.050.500.644.080.050 [Categoria DeCS]
Referências encontradas : 73 [refinar]
Mostrando: 1 .. 10   no formato [Detalhado]

página 1 de 8 ir para página                    

  1 / 73 MEDLINE  
              next record last record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:28452031
[Au] Autor:Sudsandee S; Tantrakarnapa K; Tharnpoophasiam P; Limpanont Y; Mingkhwan R; Worakhunpiset S
[Ad] Endereço:Department of Social and Environmental Medicine, Faculty of Tropical Medicine, Mahidol University, 420/6 Ratchavithi Rd, Ratchathewi, Bangkok, 10400, Thailand.
[Ti] Título:Evaluating health risks posed by heavy metals to humans consuming blood cockles (Anadara granosa) from the Upper Gulf of Thailand.
[So] Source:Environ Sci Pollut Res Int;24(17):14605-14615, 2017 Jun.
[Is] ISSN:1614-7499
[Cp] País de publicação:Germany
[La] Idioma:eng
[Ab] Resumo:There is global concern about heavy metal contamination in the environment. Adverse health effects can be caused by heavy metals in contaminated food and water. Therefore, environmental monitoring studies and risk assessments should be conducted periodically. In this study, we measured levels of Cd, Cr, Cu, Hg, Mn, Ni, Pb, and Zn in blood cockles (Anadara granosa) collected from three locations in the Upper Gulf of Thailand. Hazard quotients and hazard indices were calculated to evaluate the health risks posed by heavy metals in consumed blood cockles. Heavy metal concentrations in all of the blood cockle samples were lower than the relevant food standards. The hazard quotients and hazard indices were <1 in all three sampling areas, indicating that adverse health effects were not likely to be caused by exposure to heavy metals in blood cockles over a human lifetime.
[Mh] Termos MeSH primário: Arcidae
Contaminação de Alimentos
Metais Pesados/toxicidade
Medição de Risco
Poluentes Químicos da Água/toxicidade
[Mh] Termos MeSH secundário: Animais
Cardiidae
Monitoramento Ambiental
Seres Humanos
Metais Pesados/análise
Alimentos Marinhos
Tailândia
Poluentes Químicos da Água/análise
[Pt] Tipo de publicação:JOURNAL ARTICLE
[Nm] Nome de substância:
0 (Metals, Heavy); 0 (Water Pollutants, Chemical)
[Em] Mês de entrada:1712
[Cu] Atualização por classe:171215
[Lr] Data última revisão:
171215
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:170429
[St] Status:MEDLINE
[do] DOI:10.1007/s11356-017-9014-5


  2 / 73 MEDLINE  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:29101486
[Au] Autor:Sunil Kumar D; Janakiram P; Murali Krishna Kumar M; Krishna Geetha G
[Ad] Endereço:Department of Marine Living Resources, Andhra University, Visakhapatnam, Andhra Pradesh, 530003, India.
[Ti] Título:Inhibitory activity of bio-active compounds isolated from Anadara granosa in shrimp health management.
[So] Source:World J Microbiol Biotechnol;33(11):207, 2017 Nov 03.
[Is] ISSN:1573-0972
[Cp] País de publicação:Germany
[La] Idioma:eng
[Ab] Resumo:The crude extract isolated from the visceral mass of Anadara granosa, an intertidal bivalve mollusc was tested for inhibitory activity against pathogenic bacteria of the shrimp and fish viz. Vibrio harveyi and Staphylococcus aureus respectively by agar well diffusion and contact bioautography methods. Maximum inhibitory activity was shown against V. harveyi by methanol and chloroform (9:1) extract. Twelve fractions (1-12) could be separated from the crude extract through column chromatography. Five out of twelve fractions (7, 8, 9, 10, and 11) showed antibacterial activity and they were further run on column chromatography for purity. The fraction no. 9 showed highest antibacterial activity among the five and was subjected to NMR for the proton, C and H -H correlation, IR and mass spectral analysis for structural elucidation. Structure of the compound isolated from fraction no: 9 was determined as 1-(((2Z, 4Z)-dodeca-2,4-dienoyl)oxy)-3-hydroxypropan-2-yl tetradecanoate.
[Mh] Termos MeSH primário: Antibacterianos/química
Antibacterianos/farmacologia
Arcidae/química
Artemia/microbiologia
Fatores Biológicos/química
Fatores Biológicos/farmacologia
[Mh] Termos MeSH secundário: Animais
Metanol/química
Testes de Sensibilidade Microbiana
Staphylococcus aureus/efeitos dos fármacos
Vibrio/efeitos dos fármacos
[Pt] Tipo de publicação:JOURNAL ARTICLE
[Nm] Nome de substância:
0 (Anti-Bacterial Agents); 0 (Biological Factors); Y4S76JWI15 (Methanol)
[Em] Mês de entrada:1711
[Cu] Atualização por classe:171114
[Lr] Data última revisão:
171114
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:171105
[St] Status:MEDLINE
[do] DOI:10.1007/s11274-017-2340-4


  3 / 73 MEDLINE  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:28934256
[Au] Autor:Chen H; Xiao G; Chai X; Lin X; Fang J; Teng S
[Ad] Endereço:Zhejiang Mariculture Research Institute, Wenzhou, Zhejiang, China.
[Ti] Título:Transcriptome analysis of sex-related genes in the blood clam Tegillarca granosa.
[So] Source:PLoS One;12(9):e0184584, 2017.
[Is] ISSN:1932-6203
[Cp] País de publicação:United States
[La] Idioma:eng
[Ab] Resumo:BACKGROUND: Blood clams (Tegillarca granosa) are one of the most commercial shellfish in China and South Asia with wide distribution in Indo-Pacific tropical to temperate estuaries. However, recent data indicate a decline in the germplasm of this species. Furthermore, the molecular mechanisms underpinning reproductive regulation remain unclear and information regarding genetic diversity is limited. Understanding the reproductive biology of shellfish is important in interpreting their embryology development, reproduction and population structure. Transcriptome sequencing (RNA-seq) rapidly obtains genetic sequence information from almost all transcripts of a particular tissue and currently represents the most prevalent and effective method for constructing genetic expression profiles. RESULTS: Non-reference RNA-seq, an Illumina HiSeq2500 Solexa system, and de novo assembly were used to construct a gonadal expression profile of the blood clam. A total of 63.75 Gb of clean data, with at least 89.46% of Quality30 (Q30), were generated which was then combined into 214,440 transcripts and 125,673 unigenes with a mean length of 1,122.63 and 781.30 base pairs (bp). In total, 27,325 genes were annotated by comparison with public databases. Of these, 2,140 and 2,070 differentially expressed genes (DEGs) were obtained (T05 T08 vs T01 T02 T04, T06 T07 vs T01 T02 T04; in which T01-T04 and T05-T08 represent biological replicates of individual female and male clams, respectively) and classified into two groups according to the evaluation of biological replicates. Then 35 DEGs and 5 sex-related unigenes, in other similar species, were investigated using qRT-PCR, the results of which were confirmed to data arising from RNA-seq. Among the DEGs, sex-related genes were identified, including forkhead box L2 (Foxl2), sex determining region Y-box (Sox), beta-catenin (ß-catenin), chromobox homolog (CBX) and Sex-lethal (Sxl). In addition, 6,283 simple sequence repeats (SSRs) and 614,710 single nucleotide polymorphisms (SNPs) were identified from the RNA-seq results. CONCLUSIONS: This study provided the first complete gonadal transcriptome data for the blood clam and allowed us to search many aspects of gene sequence information, not limited to gender. This data will improve our understanding of the transcriptomics and reproductive biology of the blood clam. Furthermore, molecular markers such as SSRs and SNPs will be useful in the analysis of genetic evolution, bulked segregant analysis (BSA) and genome-wide association studies (GWAS). Our transcriptome data will therefore provide important genetic information for the breeding and conservation of germplasm.
[Mh] Termos MeSH primário: Arcidae/metabolismo
Caracteres Sexuais
Transcriptoma
[Mh] Termos MeSH secundário: Animais
Arcidae/genética
Análise por Conglomerados
Feminino
Expressão Gênica
Perfilação da Expressão Gênica
Biblioteca Gênica
Gônadas/metabolismo
Masculino
Repetições de Microssatélites
Polimorfismo de Nucleotídeo Único
Reação em Cadeia da Polimerase em Tempo Real
Análise de Sequência de RNA
[Pt] Tipo de publicação:COMPARATIVE STUDY; JOURNAL ARTICLE
[Em] Mês de entrada:1710
[Cu] Atualização por classe:171018
[Lr] Data última revisão:
171018
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:170922
[St] Status:MEDLINE
[do] DOI:10.1371/journal.pone.0184584


  4 / 73 MEDLINE  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:28254499
[Au] Autor:Su W; Zha S; Wang Y; Shi W; Xiao G; Chai X; Wu H; Liu G
[Ad] Endereço:College of Animal Sciences, Zhejiang University, Hangzhou, PR China.
[Ti] Título:Benzo[a]pyrene exposure under future ocean acidification scenarios weakens the immune responses of blood clam, Tegillarca granosa.
[So] Source:Fish Shellfish Immunol;63:465-470, 2017 Apr.
[Is] ISSN:1095-9947
[Cp] País de publicação:England
[La] Idioma:eng
[Ab] Resumo:Persistent organic pollutants (POPs) are known to converge into the ocean and accumulate in the sediment, posing great threats to marine organisms such as the sessile bottom burrowing bivalves. However, the immune toxicity of POPs, such as B[a]P, under future ocean acidification scenarios remains poorly understood to date. Therefore, in the present study, the impacts of B[a]P exposure on the immune responses of a bivalve species, Tegillarca granosa, under present and future ocean acidification scenarios were investigated. Results obtained revealed an increased immune toxicity of B[a]P under future ocean acidification scenarios in terms of reduced THC, altered haemocyte composition, and hampered phagocytosis, which may attribute to the synergetic effects of B[a]P and ocean acidification. In addition, the gene expressions of pathogen pattern recognition receptors (TLR1, TLR2, TLR4, TLR6), pathway mediators (TRAF6, TAK1, TAB2, IKKα and Myd88), and effectors (NF-ĸB) of the important immune related pathways were significantly down-regulated upon exposure to B[a]P under future ocean acidification scenarios. Results of the present study suggested an increased immune toxicity of B[a]P under future ocean acidification scenarios, which will significantly hamper the immune responses of T. granosa and subsequently render individuals more susceptible to pathogens challenges.
[Mh] Termos MeSH primário: Arcidae/efeitos dos fármacos
Benzo(a)pireno/toxicidade
Regulação da Expressão Gênica
Imunidade Inata/efeitos dos fármacos
Água do Mar/química
Poluentes Químicos da Água/toxicidade
[Mh] Termos MeSH secundário: Animais
Mudança Climática
Concentração de Íons de Hidrogênio
NF-kappa B/genética
NF-kappa B/metabolismo
Distribuição Aleatória
Transdução de Sinais
Receptores Toll-Like/genética
Receptores Toll-Like/metabolismo
[Pt] Tipo de publicação:JOURNAL ARTICLE
[Nm] Nome de substância:
0 (NF-kappa B); 0 (Toll-Like Receptors); 0 (Water Pollutants, Chemical); 3417WMA06D (Benzo(a)pyrene)
[Em] Mês de entrada:1705
[Cu] Atualização por classe:170501
[Lr] Data última revisão:
170501
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:170304
[St] Status:MEDLINE


  5 / 73 MEDLINE  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:28182094
[Au] Autor:Wang S; Yu X; Lin Z; Zhang S; Xue L; Xue Q; Bao Y
[Ad] Endereço:School of Marine Sciences, Ningbo University, Ningbo 315211, China; Zhejiang Key Laboratory of Aquatic Germplasm Resources, Zhejiang Wanli University, Ningbo 315100, China.
[Ti] Título:Hemoglobins Likely Function as Peroxidase in Blood Clam Hemocytes.
[So] Source:J Immunol Res;2017:7125084, 2017.
[Is] ISSN:2314-7156
[Cp] País de publicação:Egypt
[La] Idioma:eng
[Ab] Resumo:Hemoglobins are a group of respiratory proteins principally functioning in transport of oxygen and carbon dioxide in red blood cells of all vertebrates and some invertebrates. The blood clam is one of the few invertebrates that have hemoglobin-containing red hemocytes. In the present research, the peroxidase activity of hemoglobins (Tg-Hbs) was characterized and the associated mechanism of action was deciphered via structural comparison with other known peroxidases. We detected that purified Tg-Hbs catalyzed the oxidation of phenolic compounds in the presence of exogenous H O . Tg-Hbs peroxidase activity reached the maximum at pH 5 and 35°C and was inhibited by Fe , Cu , SDS, urea, and sodium azide. Tg-Hbs shared few similarities in amino acid sequence and overall structural characteristics with known peroxidases. However, the predicted structure at their heme pocket was highly similar to that of horseradish peroxidase (HRP) and myeloperoxidase (MPO). This research represented the first systemic characterization of hemoglobin as a peroxidase.
[Mh] Termos MeSH primário: Arcidae/metabolismo
Hemócitos/metabolismo
Hemoglobinas/metabolismo
Peroxidase/metabolismo
[Mh] Termos MeSH secundário: Sequência de Aminoácidos
Animais
Peróxido de Hidrogênio/química
Estrutura Terciária de Proteína
Alinhamento de Sequência
[Pt] Tipo de publicação:JOURNAL ARTICLE
[Nm] Nome de substância:
0 (Hemoglobins); BBX060AN9V (Hydrogen Peroxide); EC 1.11.1.7 (Peroxidase)
[Em] Mês de entrada:1703
[Cu] Atualização por classe:170313
[Lr] Data última revisão:
170313
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:170210
[St] Status:MEDLINE
[do] DOI:10.1155/2017/7125084


  6 / 73 MEDLINE  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:27889340
[Au] Autor:Chen Y; Li C; Zhu J; Xie W; Hu X; Song L; Zi J; Yu R
[Ad] Endereço:Biotechnological Institute of Chinese Materia Medica, Jinan University, 601 Huangpu Avenue West, Guangzhou 510632, China.
[Ti] Título:Purification and characterization of an antibacterial and anti-inflammatory polypeptide from Arca subcrenata.
[So] Source:Int J Biol Macromol;96:177-184, 2017 Mar.
[Is] ISSN:1879-0003
[Cp] País de publicação:Netherlands
[La] Idioma:eng
[Ab] Resumo:A polypeptide coded as PGC was isolated from Arca subcrenata muscle using ion exchange, Sephadex G-50 gel chromatography and RP-HPLC. PGC was identified to be a homogeneous compound by Native-PAGE and the purity was more than 98.9% measured by HPLC. The isoelectric point of PGC was determined to be 9.76 by IEF-PAGE. The molecular weight was determined to be 15,973.0Da by ESI-MS/MS. The conformational structure of PGC was characterized by UV-vis, FT-IR and CD spectroscopy. N terminal amino acid sequence of PGC was shown as PSVYDAAAQLTADVKKDLRDSWKVIGGDKKGNGVA by Edman degradation. The results demonstrated that there is a high degree of homology between PGC and the subunit from hemoglobin, and proposed that PGC is the depolymerized polypeptide of Hemoglobin I (HbI) from A. subcrenata. The evaluation of biological activities showed that the diameters of the inhibitory ring of PGC on Escherichia coli and Staphylococcus aureus were 14.5±0.44mm and 16.5±1.15mm, respectively. The IC of inhibition rate for PGC on NO production was 9.60±0.71µg/mL. Therefore, PGC might be developed as one of potential antibacterial and anti-inflammatory agents.
[Mh] Termos MeSH primário: Antibacterianos/isolamento & purificação
Antibacterianos/farmacologia
Anti-Inflamatórios/isolamento & purificação
Anti-Inflamatórios/farmacologia
Arcidae/química
Peptídeos/isolamento & purificação
Peptídeos/farmacologia
[Mh] Termos MeSH secundário: Sequência de Aminoácidos
Animais
Antibacterianos/química
Anti-Inflamatórios/química
Bactérias/efeitos dos fármacos
Sobrevivência Celular/efeitos dos fármacos
Camundongos
Óxido Nítrico/biossíntese
Peptídeos/química
Células RAW 264.7
[Pt] Tipo de publicação:JOURNAL ARTICLE
[Nm] Nome de substância:
0 (Anti-Bacterial Agents); 0 (Anti-Inflammatory Agents); 0 (Peptides); 31C4KY9ESH (Nitric Oxide)
[Em] Mês de entrada:1704
[Cu] Atualização por classe:170411
[Lr] Data última revisão:
170411
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:161128
[St] Status:MEDLINE


  7 / 73 MEDLINE  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:27845210
[Au] Autor:Zhou L; Yang A; Liu Z; Wu B; Sun X; Lv Z; Tian JT; Du M
[Ad] Endereço:Key Laboratory of Sustainable Development of Marine Fisheries, Ministry of Agriculture, Yellow Sea Fisheries Institute, Chinese Academy of Fishery Sciences, Qingdao 266071, China.
[Ti] Título:Changes in hemolymph characteristics of ark shell Scapharaca broughtonii dealt with Vibrio anguillarum challenge in vivo and various of anticoagulants in vitro.
[So] Source:Fish Shellfish Immunol;61:9-15, 2017 Feb.
[Is] ISSN:1095-9947
[Cp] País de publicação:England
[La] Idioma:eng
[Ab] Resumo:The ark shell Scapharca broughtonii is a commercially important shellfish in China. Alserver's solution (AS), modified Alserver's solution (MAS) and Heparin sodium solution (HSS) are common anticoagulants used for shellfish blood. To observe the immune response mediated by its hemocytes, we challenged in vivo S. broughtonii hemolymph with Vibrio anguillarum and dealt with the following three anticoagulants in vitro: Alserver's solution (AS), modified Alserver's solution (MAS) and Heparin sodium solution (HSS). The methodologies we used were immunostimulation with V. anguillarum, Wright-Giemsa staining, micro-examination, and flow cytometric and hydrolyzing enzyme activity analysis. The results showed that all three types of anticoagulants effectively prevented blood clotting in ark shellfish. The morphology of hemocytes did not significantly change 30 h after anticoagulant treatment, except for the shrinking of hemocytes after administering HSS. The size and permeability of hemocytes changed when treated with the anticoagulants and when stimulated with V. anguillarum. Both alkaline phosphatase (AKP) and acid phosphatase (ACP) in hemocytes and Plasma were measured at different times after they were stimulated with V. anguillarum in HSS and MAS. The AKP enzymatic activity in HSS was somewhat higher than in the MAS anticoagulant, but changes in response to V. anguillarum challenge of enzymatic activity were almost the same in HSS and MAS groups. In conclusion, all three types of anticoagulants may be used for ark shell blood preservation. They all changed the cell-surface characteristics of hemocytes to inhibit clot formation. The AS anticoagulant was appropriate for maintaining white and red cell shapes, while MAS was ideal for retaining throbus cell function. Lastly, HSS was appropriate for maintaining enzymatic activity in hemolymph and function of hemocytes. Following this investigation, we gained insight into the changes in hemolymph characteristic during immune response.
[Mh] Termos MeSH primário: Anticoagulantes/farmacologia
Arcidae/efeitos dos fármacos
Arcidae/microbiologia
Vibrio/fisiologia
[Mh] Termos MeSH secundário: Animais
Coagulação Sanguínea/efeitos dos fármacos
Hemócitos/efeitos dos fármacos
Hemócitos/microbiologia
Heparina/farmacologia
[Pt] Tipo de publicação:JOURNAL ARTICLE
[Nm] Nome de substância:
0 (Anticoagulants); 9005-49-6 (Heparin)
[Em] Mês de entrada:1704
[Cu] Atualização por classe:170410
[Lr] Data última revisão:
170410
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:161116
[St] Status:MEDLINE


  8 / 73 MEDLINE  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:27744059
[Au] Autor:Sánchez-Ortiz AC; Angulo C; Luna-González A; Álvarez-Ruiz P; Mazón-Suástegui JM; Campa-Córdova ÁI
[Ad] Endereço:Centro de Investigaciones Biológicas del Noroeste (CIBNOR), Mar Bermejo 195, Col., Playa Palo de Santa Rita, La Paz, B.C.S., C.P. 23090, Mexico.
[Ti] Título:Effect of mixed-Bacillus spp isolated from pustulose ark Anadara tuberculosa on growth, survival, viral prevalence and immune-related gene expression in shrimp Litopenaeus vannamei.
[So] Source:Fish Shellfish Immunol;59:95-102, 2016 Dec.
[Is] ISSN:1095-9947
[Cp] País de publicação:England
[La] Idioma:eng
[Ab] Resumo:The widespread overuse of antibiotics in aquaculture has led to the emergence of antibiotic-resistance shrimp pathogens, the negative impact on shrimp gut microbiota, and the presence of antimicrobial residues in aquaculture products, with negative consequences on human health. Alternatively, probiotics have positive effects on immunological responses and productive performance of aquatic animals. In this study, three probiotic bacteria, (Bacillus licheniformis MAt32, B. subtilis MAt43 and B. subtilis subsp. subtilis GAtB1), isolated from the Anadara tuberculosa were included in diets for juvenile shrimp, Litopenaeus vannamei, to evaluate their effects on growth, survival, disease prevalence, and immune-related gene expression. Shrimp naturally infected with WSSV and IHHNV were fed with the basal diet (control, T1) and diets supplemented with four levels of bacilli probiotic mix (1:1:1) at final concentration of (T2) 1 × 10 , (T3) 2 × 10 , (T4) 4 × 10 , and (T5) 6 × 10 CFU g of feed. The specific growth rate of shrimp was significantly higher in T2 than in T1 (control) treatment, and the final growth as well as the survival were similar among treated groups. The prevalence of WSSV and IHHNV infected shrimp was reduced in T2 and T4 treatments, respectively, compared with control. The mRNA expression of proPO gene was higher in treatment T4 than control. The LvToll1 gene was significantly up-regulated in treatments T4 and T5 compared to control. The SOD gene was up-regulated in treatment T5 compared to control. In contrast, the mRNA expression of the Hsp70 gene was down-regulated in treatments T4 and T5 respect to control, and the TGase gene remained unaffected by the level of bacillus probiotic mix. As conclusion, the bacilli probiotic mix (Bacillus spp.) enhanced immune-related gene expression in WSSV and IHHNV naturally infected shrimp. This is the first report of probiotic potential of bacteria isolated from A. tuberculosa on the immune response and viral prevalence in shrimp Litopenaeus vannamei.
[Mh] Termos MeSH primário: Arcidae/microbiologia
Bacillus/imunologia
Imunidade Inata/imunologia
Penaeidae/efeitos dos fármacos
Penaeidae/fisiologia
Probióticos
[Mh] Termos MeSH secundário: Ração Animal/análise
Animais
Proteínas de Artrópodes/genética
Proteínas de Artrópodes/metabolismo
Densovirinae/fisiologia
Dieta
Penaeidae/imunologia
Penaeidae/virologia
Probióticos/química
Regulação para Cima
Vírus 1 da Síndrome da Mancha Branca/fisiologia
[Pt] Tipo de publicação:JOURNAL ARTICLE
[Nm] Nome de substância:
0 (Arthropod Proteins)
[Em] Mês de entrada:1703
[Cu] Atualização por classe:170321
[Lr] Data última revisão:
170321
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:161106
[St] Status:MEDLINE


  9 / 73 MEDLINE  
              first record previous record next record last record
seleciona
para imprimir
Fotocópia
[PMID]:27228707
[Au] Autor:Tabakaeva OV; Tabakaev AV
[Ti] Título:[Micronutrient structure of food parts of a trade bivalve mollusc of Anadara broughtoni].
[So] Source:Vopr Pitan;85(1):92-8, 2016.
[Is] ISSN:0042-8833
[Cp] País de publicação:Russia (Federation)
[La] Idioma:rus
[Ab] Resumo:The content of micronutrients in food parts of a bivalve mollusk of the Far East region of Anadara broughtoni has been defined. It is established that in a muscle the prevailing mineral is potassium, in a cloak with a adductor--sodium. In Anadara broughtoni muscle concentration of potassium reaches 490 mg/100 g of crude tissue that is 2-3 fold higher than the content of this element in combs and oysters and 4 fold above, than in a cloak. For sodium inverse relationship is observed: its contents in a cloak (439 mg/100 g) is 3 fold more, than in a muscle. The low content of sodium in an adductor should be noted. For all food parts of a mollusk of Anadara broughtoni the dominating trace elements are iron and zinc. The content of iron is maximum in a muscle (4.84 mg/100 g) and exceeds that in an adductor by 1.84 fold. The content of zinc in food parts differs insignificantly, the maximum contents is defined in a cloak (2.12 mg/100 g), in comparison with an adductor excess makes only 15%. It should be noted the high content of manganese--especially in a cloak (1.12 mg/100 g)--in comparison with an adductor 43.5% more. Chromium content in a muscle (0.018 mg/100 g) exceeds that in an adductor 2.25 times. The high content of copper in a muscle (0.04 mg/100 g)--4 times old higher than in an adductor is defined. The content of selenium and of iodine is maximum in a muscle (0.03 mg/100 g). For a cloak and a muscle the prevailing class of lipids are phospholipids, for an adductor--cholesterol. The content of cholesterol in an adductor is 2 7-37% more, than in other food parts of a mollusk. The level of total carotenoids in a motive muscle (5.7 mg/100 g) 1.78 fold exceeds the contents in an adductor and by 1.5 fold elevates the contents in a cloak. The main share of carotenoids is concentrated in a motive muscle.
[Mh] Termos MeSH primário: Arcidae/química
Análise de Alimentos
Micronutrientes/análise
Alimentos Marinhos/análise
[Mh] Termos MeSH secundário: Animais
Seres Humanos
[Pt] Tipo de publicação:ENGLISH ABSTRACT; JOURNAL ARTICLE
[Nm] Nome de substância:
0 (Micronutrients)
[Em] Mês de entrada:1606
[Cu] Atualização por classe:160527
[Lr] Data última revisão:
160527
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:160528
[St] Status:MEDLINE


  10 / 73 MEDLINE  
              first record previous record
seleciona
para imprimir
Fotocópia
Texto completo
[PMID]:27132029
[Au] Autor:Kobelja K; Nemet I; Zupan I; Culin J; Roncevic S
[Ad] Endereço:Laboratory of Analytical Chemistry, Faculty of Science, University of Zagreb, Croatia.
[Ti] Título:Elemental profiling of Noah's Ark shell (Arca noae, Linnaeus, 1758) by plasma optical spectrometry and chemometric tools.
[So] Source:J Trace Elem Med Biol;38:157-164, 2016 Dec.
[Is] ISSN:1878-3252
[Cp] País de publicação:Germany
[La] Idioma:eng
[Ab] Resumo:Determination of metal content in biominerals provides essential information with respect to relations between biomineralization processes and environmental status. Mussels are species that have a great potential as bio-marker species and therefore, they are in the focus of numerous biomineralization and ecological studies. In this study, elemental profile of mussel shell of Noah's Ark (Arca noe, Linnaeus, 1758), which inhabit eastern Adriatic Sea was obtained by determination of seventeen elements content using inductively coupled plasma optical emission spectrometry (ICP-OES). Shell samples were collected from marine protected area and from marine shipping route in eastern Adriatic Sea. The accuracy of applied analytical procedure based on microwave decomposition of shell samples was tested by use of reference materials of limestone and by matrix-matched standards. By aid of chemometric methods, the elemental profile along with variability of elements content of shell was obtained. The impact of different environment on elements content was established by use of multivariate statistical PCA method. Discernment between two groups of samples was manifested. Among results of main, minor and trace elements content, the last one which denoted to Cd, Co, Cu, Pb, and Mn was expressed as principal distinctive feature of shell samples collected from different sampling sites. Elemental profiling of mussel shell Noah's Ark provides novel insight in species status as well as in environmental status on the observed locations.
[Mh] Termos MeSH primário: Arcidae/química
Bivalves/química
Oligoelementos/análise
[Mh] Termos MeSH secundário: Animais
Espectrometria de Massas
Análise Espectral
[Pt] Tipo de publicação:JOURNAL ARTICLE
[Nm] Nome de substância:
0 (Trace Elements)
[Em] Mês de entrada:1706
[Cu] Atualização por classe:170601
[Lr] Data última revisão:
170601
[Sb] Subgrupo de revista:IM
[Da] Data de entrada para processamento:160502
[St] Status:MEDLINE



página 1 de 8 ir para página                    
   


Refinar a pesquisa
  Base de dados : MEDLINE Formulário avançado   

    Pesquisar no campo  
1  
2
3
 
           



Search engine: iAH v2.6 powered by WWWISIS

BIREME/OPAS/OMS - Centro Latino-Americano e do Caribe de Informação em Ciências da Saúde